eF-site ID 4lg0-A PDB Code 4lg0 Chain A click to enlarge Title Structure of a ternary FOXO1-ETS1 DNA complex Classification TRANSCRIPTION/DNA Compound Forkhead box protein O1 Source Homo sapiens (Human) (4LG0) Sequence A:  RRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVP YFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSS WWMLNPEGG Description Functional site 1) chain A residue 217 type sequence L description BINDING SITE FOR RESIDUE CA A 301 source : AC1 2) chain A residue 218 type sequence S description BINDING SITE FOR RESIDUE CA A 301 source : AC1 3) chain A residue 220 type sequence H description BINDING SITE FOR RESIDUE CA A 301 source : AC1 4) chain A residue 223 type sequence F description BINDING SITE FOR RESIDUE CA A 301 source : AC1 5) chain A residue 209-215 type prosite sequence WKNSIRH description FORK_HEAD_2 Fork head domain signature 2. WKNSIRH source prosite : PS00658 6) chain A residue 158 type SITE sequence N description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 165 type SITE sequence Y description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 225 type SITE sequence R description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 212 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403, ECO:0000269|PubMed:19221179, ECO:0000269|PubMed:21245099 source Swiss-Prot : SWS_FT_FI3 10) chain A residue 218 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 11) chain A residue 234 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 12) chain A residue 235 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links