eF-site ID 4ldt-A PDB Code 4ldt Chain A click to enlarge Title The structure of h/ceOTUB1-ubiquitin aldehyde-UBCH5B~Ub Classification HYDROLASE REGULATOR Compound Ubiquitin thioesterase otubain-like Source Caenorhabditis elegans (UBC_HUMAN) Sequence A:  CLAYDEAIMAQQDRIQQEIAVQNPLVATLAPFSILCAEYD NETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLI EIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDF FIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITS AFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAI NSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDQIAPEIT LLYRPGHYDVIYKKD Description Functional site 1) chain A residue 101 type sequence M description BINDING SITE FOR RESIDUE EDO A 301 source : AC1 2) chain A residue 102 type sequence L description BINDING SITE FOR RESIDUE EDO A 301 source : AC1 3) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE EDO A 301 source : AC1 4) chain A residue 146 type sequence I description BINDING SITE FOR RESIDUE EDO A 301 source : AC1 5) chain A residue 155 type sequence A description BINDING SITE FOR RESIDUE EDO A 302 source : AC2 6) chain A residue 158 type sequence T description BINDING SITE FOR RESIDUE EDO A 302 source : AC2 7) chain A residue 192 type sequence I description BINDING SITE FOR RESIDUE EDO A 303 source : AC3 8) chain A residue 193 type sequence D description BINDING SITE FOR RESIDUE EDO A 303 source : AC3 9) chain A residue 194 type sequence E description BINDING SITE FOR RESIDUE EDO A 303 source : AC3 10) chain A residue 201 type sequence Y description BINDING SITE FOR RESIDUE EDO A 303 source : AC3 11) chain A residue 214 type sequence D description BINDING SITE FOR RESIDUE EDO A 303 source : AC3 12) chain A residue 216 type sequence L description BINDING SITE FOR RESIDUE EDO A 303 source : AC3 13) chain A residue 245 type CROSSLNK sequence H description Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins) source Swiss-Prot : SWS_FT_FI7 14) chain A residue 267 type MOD_RES sequence H description ADP-ribosylglycine => ECO:0000269|PubMed:28525742 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links