eF-site ID 4lc2-A PDB Code 4lc2 Chain A click to enlarge Title Crystal structure of the bromodomain of human BRPF1B Classification DNA BINDING PROTEIN Compound Peregrin Source Homo sapiens (Human) (BRPF1_HUMAN) Sequence A:  EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYL DHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLK YNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG Description Functional site 1) chain A residue 702 type sequence S description BINDING SITE FOR RESIDUE NO3 A 801 source : AC1 2) chain A residue 705 type sequence L description BINDING SITE FOR RESIDUE NO3 A 801 source : AC1 3) chain A residue 706 type sequence K description BINDING SITE FOR RESIDUE NO3 A 801 source : AC1 4) chain A residue 715 type sequence Y description BINDING SITE FOR RESIDUE NO3 A 801 source : AC1 5) chain A residue 722 type sequence R description BINDING SITE FOR RESIDUE NO3 A 801 source : AC1 6) chain A residue 648 type sequence D description BINDING SITE FOR RESIDUE EDO A 802 source : AC2 7) chain A residue 649 type sequence T description BINDING SITE FOR RESIDUE EDO A 802 source : AC2 8) chain A residue 650 type sequence G description BINDING SITE FOR RESIDUE EDO A 802 source : AC2 9) chain A residue 688 type sequence L description BINDING SITE FOR RESIDUE EDO A 802 source : AC2 10) chain A residue 689 type sequence N description BINDING SITE FOR RESIDUE EDO A 802 source : AC2 11) chain A residue 720 type sequence R description BINDING SITE FOR RESIDUE EDO A 802 source : AC2 12) chain A residue 650-707 type prosite sequence GNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN FDDFEEDFNLIVSNCLKY description BROMODOMAIN_1 Bromodomain signature. GniFsepvPlsevp..DYLdhIkkpMdfftMkqnleayr..Ylnfddfeedfnl.IvsNClkY source prosite : PS00633

Display surface Download Links