eF-site ID 4l7e-A PDB Code 4l7e Chain A click to enlarge Title Three dimensional structure of mutant D78A of human HD domain-containing protein 2, Genomics Consortium (NESG) Target HR6723 Classification SIGNALING PROTEIN Compound HD domain-containing protein 2 Source Homo sapiens (Human) (HDDC2_HUMAN) Sequence A:  HGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHXY RXAVXAXVIKDDRLNKDRCVRLALVHAXAECIVGDIAPAD NIPKEEKHRREEEAXKQITQLLPEDLRKELYELWEEYETQ SSAEAKFVKQLDQCEXILQASEYEDLEHKPGRLQDFYDST AGKFNHPEIVQLVSELEAERSTNIAAA Description Functional site 1) chain A residue 32 type sequence R description BINDING SITE FOR RESIDUE CL A 301 source : AC1 2) chain A residue 49 type sequence H description BINDING SITE FOR RESIDUE CL A 301 source : AC1 3) chain A residue 77 type sequence H description BINDING SITE FOR RESIDUE CL A 301 source : AC1 4) chain A residue 143 type sequence D description BINDING SITE FOR RESIDUE CL A 301 source : AC1 5) chain A residue 173 type sequence G description BINDING SITE FOR RESIDUE PEG A 302 source : AC2 6) chain A residue 176 type sequence N description BINDING SITE FOR RESIDUE PEG A 302 source : AC2 7) chain A residue 132 type sequence S description BINDING SITE FOR RESIDUE PEG A 303 source : AC3 8) chain A residue 137 type sequence K description BINDING SITE FOR RESIDUE PEG A 303 source : AC3 9) chain A residue 41 type sequence Q description BINDING SITE FOR RESIDUE PEG A 304 source : AC4 10) chain A residue 158 type sequence E description BINDING SITE FOR RESIDUE PEG A 304 source : AC4 11) chain A residue 160 type sequence K description BINDING SITE FOR RESIDUE PEG A 304 source : AC4 12) chain A residue 163 type sequence R description BINDING SITE FOR RESIDUE PEG A 304 source : AC4 13) chain A residue 82 type sequence C description BINDING SITE FOR RESIDUE PEG A 305 source : AC5 14) chain A residue 83 type sequence I description BINDING SITE FOR RESIDUE PEG A 305 source : AC5 15) chain A residue 85 type sequence G description BINDING SITE FOR RESIDUE PEG A 305 source : AC5 16) chain A residue 166 type sequence D description BINDING SITE FOR RESIDUE PEG B 302 source : AC7 17) chain A residue 90 type sequence A description BINDING SITE FOR RESIDUE PEG B 306 source : BC1 18) chain A residue 92 type sequence N description BINDING SITE FOR RESIDUE PEG B 306 source : BC1 19) chain A residue 49 type BINDING sequence H description BINDING => ECO:0007744|PDB:4DMB source Swiss-Prot : SWS_FT_FI1 20) chain A residue 77 type BINDING sequence H description BINDING => ECO:0007744|PDB:4DMB source Swiss-Prot : SWS_FT_FI1 21) chain A residue 78 type BINDING sequence A description BINDING => ECO:0007744|PDB:4DMB source Swiss-Prot : SWS_FT_FI1 22) chain A residue 143 type BINDING sequence D description BINDING => ECO:0007744|PDB:4DMB source Swiss-Prot : SWS_FT_FI1 23) chain A residue 81 type BINDING sequence E description BINDING => ECO:0007744|PDB:4L7W source Swiss-Prot : SWS_FT_FI2 24) chain A residue 86 type BINDING sequence D description BINDING => ECO:0007744|PDB:4L7W source Swiss-Prot : SWS_FT_FI2 25) chain A residue 87 type BINDING sequence I description BINDING => ECO:0007744|PDB:4L7W source Swiss-Prot : SWS_FT_FI2

Display surface Download Links