eF-site ID 4kd5-C PDB Code 4kd5 Chain C click to enlarge Title substrate binding domain of putative molybdenum ABC transporter from Clostridium difficile Classification TRANSPORT PROTEIN Compound ABC-type transport system, molybdenum-specific extracellular solute-binding protein Source Peptoclostridium difficile (strain 630) (Clostridium difficile) (Q18A64_CLOD6) Sequence C:  SVELNISAAASLKEAXAKIEEEYKKVDSNVKLTVNYGASG SLQQQIEQGAPCDLFISAGQKQXKVLDEEKLLVSDTXKDL VKNDLVLISSADSSVSGXKDLTTDKVKKIAVGEAESVPAG KYADEVLTNLNLKDKLKDKLVFAKDVKEVLAWVQSGNADV GFVYFSDTVNNDKIKVVEKTDEKTHSPITYPVSVIKASKN VDAAKKFEEFLLSESGQKIFEEFGYKKVE Description (1)  ABC-type transport system, molybdenum-specific extracellular solute-binding protein Functional site 1) chain C residue 139 type sequence X description BINDING SITE FOR RESIDUE FMT C 300 source : AC1 2) chain C residue 140 type sequence K description BINDING SITE FOR RESIDUE FMT C 300 source : AC1 3) chain C residue 219 type sequence E description BINDING SITE FOR RESIDUE FMT C 300 source : AC1 4) chain C residue 241 type sequence N description BINDING SITE FOR RESIDUE FMT C 301 source : AC2 5) chain C residue 243 type sequence D description BINDING SITE FOR RESIDUE FMT C 301 source : AC2 6) chain C residue 244 type sequence A description BINDING SITE FOR RESIDUE FMT C 301 source : AC2 7) chain C residue 100 type sequence G description BINDING SITE FOR RESIDUE SBT C 302 source : AC3 8) chain C residue 101 type sequence Q description BINDING SITE FOR RESIDUE SBT C 302 source : AC3 9) chain C residue 102 type sequence K description BINDING SITE FOR RESIDUE SBT C 302 source : AC3 10) chain C residue 87 type sequence I description BINDING SITE FOR RESIDUE FMT C 303 source : AC4 11) chain C residue 112 type sequence L description BINDING SITE FOR RESIDUE FMT C 303 source : AC4 12) chain C residue 236 type sequence I description BINDING SITE FOR RESIDUE FMT C 303 source : AC4 13) chain C residue 237 type sequence K description BINDING SITE FOR RESIDUE FMT C 303 source : AC4 14) chain C residue 238 type sequence A description BINDING SITE FOR RESIDUE FMT C 303 source : AC4 15) chain C residue 145 type sequence D description BINDING SITE FOR RESIDUE SBT C 304 source : AC5

Display surface Download Links