eF-site ID 4k1r-A PDB Code 4k1r Chain A click to enlarge Title Crystal structure of Schizosaccharomyces pombe sst2 catalytic domain and Ubiquitin Classification HYDROLASE Compound AMSH-like protease sst2 Source Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (UBC_HUMAN) Sequence A:  TFKIHAYTEGGKPLRTIYLPKLLKKVFLDVVKPNTKKNLE TCGILCGKLRQNAFFITHLVIPLQEATSDTCGTTDEASLF EFQDKHNLLTLGWIHTHPTQTCFMSSVDLHTHCSYQLMLP EAIAIVMAPSKNTSGIFRLLDPEGLQTIVKCRKPGLFHPH EGKVYTMVAQPGHVREINSKLQVVDLRVK Description Functional site 1) chain A residue 304 type sequence H description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 2) chain A residue 332 type sequence H description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 3) chain A residue 341 type sequence H description BINDING SITE FOR RESIDUE ZN A 502 source : AC2 4) chain A residue 343 type sequence H description BINDING SITE FOR RESIDUE ZN A 502 source : AC2 5) chain A residue 354 type sequence D description BINDING SITE FOR RESIDUE ZN A 502 source : AC2 6) chain A residue 356 type sequence H description BINDING SITE FOR RESIDUE ZN A 503 source : AC3 7) chain A residue 397 type sequence C description BINDING SITE FOR RESIDUE ZN A 503 source : AC3 8) chain A residue 404 type sequence H description BINDING SITE FOR RESIDUE ZN A 503 source : AC3 9) chain A residue 406 type sequence H description BINDING SITE FOR RESIDUE ZN A 503 source : AC3 10) chain A residue 304 type sequence H description BINDING SITE FOR RESIDUE CL A 504 source : AC4 11) chain A residue 332 type sequence H description BINDING SITE FOR RESIDUE CL A 504 source : AC4 12) chain A residue 428 type sequence Q description BINDING SITE FOR RESIDUE CL A 504 source : AC4 13) chain A residue 329 type sequence Q description BINDING SITE FOR RESIDUE EDO A 505 source : AC5 14) chain A residue 333 type sequence N description BINDING SITE FOR RESIDUE EDO A 505 source : AC5 15) chain A residue 334 type sequence L description BINDING SITE FOR RESIDUE EDO A 505 source : AC5 16) chain A residue 335 type sequence L description BINDING SITE FOR RESIDUE EDO A 505 source : AC5 17) chain A residue 346 type sequence Q description BINDING SITE FOR RESIDUE EDO A 506 source : AC6 18) chain A residue 349 type sequence F description BINDING SITE FOR RESIDUE EDO A 506 source : AC6 19) chain A residue 345 type sequence T description BINDING SITE FOR RESIDUE EDO A 507 source : AC7 20) chain A residue 376 type sequence S description BINDING SITE FOR RESIDUE EDO A 507 source : AC7 21) chain A residue 377 type sequence K description BINDING SITE FOR RESIDUE EDO A 507 source : AC7 22) chain A residue 270 type sequence K description BINDING SITE FOR RESIDUE EDO A 508 source : AC8 23) chain A residue 380 type sequence S description BINDING SITE FOR RESIDUE EDO A 508 source : AC8 24) chain A residue 381 type sequence G description BINDING SITE FOR RESIDUE EDO A 508 source : AC8 25) chain A residue 382 type sequence I description BINDING SITE FOR RESIDUE EDO A 508 source : AC8 26) chain A residue 416 type sequence Q description BINDING SITE FOR RESIDUE EDO A 508 source : AC8 27) chain A residue 422 type sequence E description BINDING SITE FOR RESIDUE EDO A 508 source : AC8 28) chain A residue 294 type sequence K description BINDING SITE FOR RESIDUE EDO A 509 source : AC9 29) chain A residue 296 type sequence R description BINDING SITE FOR RESIDUE EDO A 509 source : AC9 30) chain A residue 327 type sequence E description BINDING SITE FOR RESIDUE ZN C 503 source : BC4 31) chain A residue 327 type sequence E description BINDING SITE FOR RESIDUE CL C 504 source : BC5 32) chain A residue 328 type sequence F description BINDING SITE FOR RESIDUE CL C 504 source : BC5 33) chain A residue 311 type sequence E description BINDING SITE FOR RESIDUE EDO C 505 source : BC6 34) chain A residue 316 type sequence T description BINDING SITE FOR RESIDUE EDO C 505 source : BC6 35) chain A residue 317 type sequence C description BINDING SITE FOR RESIDUE EDO C 505 source : BC6 36) chain A residue 318 type sequence G description BINDING SITE FOR RESIDUE EDO C 505 source : BC6 37) chain A residue 353 type MOD_RES sequence V description ADP-ribosylglycine => ECO:0000269|PubMed:28525742 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 396 type CROSSLNK sequence K description Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins) source Swiss-Prot : SWS_FT_FI2 39) chain A residue 405 type CROSSLNK sequence P description Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins) source Swiss-Prot : SWS_FT_FI2 40) chain A residue 285 type SITE sequence L description Indirect zinc-binding => ECO:0000250 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links