eF-site ID 4k0g-A PDB Code 4k0g Chain A click to enlarge Title Crystal structure of human CLIC1 C24S mutant Classification TRANSPORT PROTEIN Compound Chloride intracellular channel protein 1 Source Homo sapiens (Human) (CLIC1_HUMAN) Sequence A:  QPQVELFVKAGSDGAKIGNSPFSQRLFMVLWLKGVTFNVT TVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFL EAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPA LNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQ RKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFR GVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK Description Functional site 1) chain A residue 196 type sequence G description BINDING SITE FOR RESIDUE CA A 301 source : AC1 2) chain A residue 196 type sequence G description BINDING SITE FOR RESIDUE CA A 301 source : AC1 3) chain A residue 38 type sequence G description BINDING SITE FOR RESIDUE ACT A 302 source : AC2 4) chain A residue 92 type sequence R description BINDING SITE FOR RESIDUE ACT A 302 source : AC2 5) chain A residue 113 type sequence K description BINDING SITE FOR RESIDUE ACT A 302 source : AC2 6) chain A residue 26-46 type TRANSMEM sequence FSQRLFMVLWLKGVTFNVTTV description Helical; Note=After insertion into the membrane => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 77 type BINDING sequence T description BINDING => ECO:0000269|PubMed:11551966 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 64 type BINDING sequence L description BINDING => ECO:0000269|PubMed:11551966 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 119 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 10) chain A residue 131 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 11) chain A residue 13 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 12) chain A residue 24 type MOD_RES sequence S description S-glutathionyl cysteine; alternate => ECO:0000269|PubMed:14613939 source Swiss-Prot : SWS_FT_FI5 13) chain A residue 156 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI6 14) chain A residue 211 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI6 15) chain A residue 121 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI6 16) chain A residue 233 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:Q9Z1Q5 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links