eF-site ID 4jzj-L
PDB Code 4jzj
Chain L

click to enlarge
Title Crystal Structure of Receptor-Fab Complex
Classification CYTOKINE RECEPTOR/IMMUNE SYSTEM
Compound Interleukin-3 receptor subunit alpha
Source ORGANISM_COMMON: mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence L:  DIVMTQSPDSLAVSLGERATINCESSQSLLNSGNQKNYLT
WYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQNDYSYPYTFGQGTKLEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC
EVTHQGLSSPVTKSFNRGE
Description (1)  Interleukin-3 receptor subunit alpha, Fab Heavy Chain, Fab Light Chain


Functional site

1) chain L
residue 168
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

2) chain L
residue 182
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

3) chain L
residue 184
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

4) chain L
residue 100
type binding
ligand FUL: BETA-L-FUCOSE
sequence Y
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

5) chain L
residue 139
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

6) chain L
residue 166
type binding
ligand GOL: GLYCEROL
sequence Q
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

7) chain L
residue 168
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

8) chain L
residue 182
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

9) chain L
residue 184
type binding
ligand GOL: GLYCEROL
sequence T
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301


Display surface

Download
Links