eF-site ID 4jzj-H
PDB Code 4jzj
Chain H

click to enlarge
Title Crystal Structure of Receptor-Fab Complex
Classification CYTOKINE RECEPTOR/IMMUNE SYSTEM
Compound Interleukin-3 receptor subunit alpha
Source ORGANISM_COMMON: mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence H:  EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQM
PGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTY
LQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSS
ASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPK
Description (1)  Interleukin-3 receptor subunit alpha, Fab Heavy Chain, Fab Light Chain


Functional site

1) chain H
residue 174
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

2) chain H
residue 176
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

3) chain H
residue 184
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

4) chain H
residue 185
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

5) chain H
residue 186
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

6) chain H
residue 55
type
ligand
sequence N
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

7) chain H
residue 57
type
ligand
sequence A
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

8) chain H
residue 58
type
ligand
sequence T
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

9) chain H
residue 59
type
ligand
sequence F
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

10) chain H
residue 60
type
ligand
sequence Y
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

11) chain H
residue 62
type
ligand
sequence Q
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

12) chain H
residue 65
type
ligand
sequence K
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

13) chain H
residue 58-60
type binding
ligand FUL: BETA-L-FUCOSE
sequence TFY
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

14) chain H
residue 62
type binding
ligand FUL: BETA-L-FUCOSE
sequence Q
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

15) chain H
residue 65
type binding
ligand FUL: BETA-L-FUCOSE
sequence K
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

16) chain H
residue 58
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

17) chain H
residue 56-59
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GATF
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_403

18) chain H
residue 55-57
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence NGA
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_4jzj_C_405

19) chain H
residue 55-58
type binding
ligand BMA: BETA-D-MANNOSE
sequence NGAT
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_4jzj_C_404

20) chain H
residue 60
type binding
ligand BMA: BETA-D-MANNOSE
sequence Y
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_4jzj_C_404

21) chain H
residue 148
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

22) chain H
residue 173-176
type binding
ligand GOL: GLYCEROL
sequence FPAV
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

23) chain H
residue 184-186
type binding
ligand GOL: GLYCEROL
sequence SLS
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301


Display surface

Download
Links