eF-site ID 4jzj-D
PDB Code 4jzj
Chain D

click to enlarge
Title Crystal Structure of Receptor-Fab Complex
Classification CYTOKINE RECEPTOR/IMMUNE SYSTEM
Compound Interleukin-3 receptor subunit alpha
Source ORGANISM_COMMON: mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence D:  PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVN
NSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPW
AGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAK
RQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVR
GRSAAFGIPCTDKFVVFSQIEILTPPNMTAKSFMHWKMRS
HFNRKFRYELQIQVITEQVRDRTSFQLYTVQIRARERVYE
FLSAWSTPQRF
Description (1)  Interleukin-3 receptor subunit alpha, Fab Heavy Chain, Fab Light Chain


Functional site

1) chain D
residue 184
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL D 410
source : AC2

2) chain D
residue 80
type
ligand
sequence N
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

3) chain D
residue 82
type
ligand
sequence T
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

4) chain D
residue 93
type
ligand
sequence W
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

5) chain D
residue 108
type
ligand
sequence E
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

6) chain D
residue 109
type
ligand
sequence N
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

7) chain D
residue 125
type
ligand
sequence A
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

8) chain D
residue 53
type binding
ligand FUL: BETA-L-FUCOSE
sequence V
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

9) chain D
residue 56
type binding
ligand FUL: BETA-L-FUCOSE
sequence A
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

10) chain D
residue 82
type binding
ligand FUL: BETA-L-FUCOSE
sequence T
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

11) chain D
residue 75
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

12) chain D
residue 96
type binding
ligand GOL: GLYCEROL
sequence F
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

13) chain D
residue 182
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

14) chain D
residue 184
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

15) chain D
residue 194
type binding
ligand GOL: GLYCEROL
sequence C
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

16) chain D
residue 80
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_401

17) chain D
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_401

18) chain D
residue 93
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_401

19) chain D
residue 95
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_401

20) chain D
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_402

21) chain D
residue 91
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence S
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_402

22) chain D
residue 93
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_402

23) chain D
residue 93
type binding
ligand FUL: BETA-L-FUCOSE
sequence W
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_405

24) chain D
residue 108-109
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence EN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_407

25) chain D
residue 125-126
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AV
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_407

26) chain D
residue 108
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_4jzj_D_408

27) chain D
residue 128
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence P
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_4jzj_D_408

28) chain D
residue 109
type binding
ligand FUL: BETA-L-FUCOSE
sequence N
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_406


Display surface

Download
Links