eF-site ID 4jzj-C
PDB Code 4jzj
Chain C

click to enlarge
Title Crystal Structure of Receptor-Fab Complex
Classification CYTOKINE RECEPTOR/IMMUNE SYSTEM
Compound Interleukin-3 receptor subunit alpha
Source ORGANISM_COMMON: mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence C:  NPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAV
NNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENPWAG
AENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAKRQ
QYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGR
SAAFGIPCTDKFVVFSQIEILTPPNMTAKSFMHWKMRSHF
NRKFRYELQIQVITEQVRDRTSFQLLNPTVQIRARERVYE
FLSAWSTPQR
Description (1)  Interleukin-3 receptor subunit alpha, Fab Heavy Chain, Fab Light Chain


Functional site

1) chain C
residue 46
type
ligand
sequence N
description BINDING SITE FOR MONO-SACCHARIDE NAG C 408 BOUND TO ASN C 46
source : AC4

2) chain C
residue 48
type
ligand
sequence T
description BINDING SITE FOR MONO-SACCHARIDE NAG C 408 BOUND TO ASN C 46
source : AC4

3) chain C
residue 56
type
ligand
sequence A
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

4) chain C
residue 80
type
ligand
sequence N
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

5) chain C
residue 82
type
ligand
sequence T
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

6) chain C
residue 91
type
ligand
sequence S
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

7) chain C
residue 93
type
ligand
sequence W
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

8) chain C
residue 95
type
ligand
sequence L
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

9) chain C
residue 118
type
ligand
sequence D
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

10) chain C
residue 171
type
ligand
sequence R
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

11) chain C
residue 228
type
ligand
sequence R
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

12) chain C
residue 46-48
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NVT
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_408

13) chain C
residue 53
type binding
ligand FUL: BETA-L-FUCOSE
sequence V
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

14) chain C
residue 56
type binding
ligand FUL: BETA-L-FUCOSE
sequence A
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

15) chain C
residue 82
type binding
ligand FUL: BETA-L-FUCOSE
sequence T
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

16) chain C
residue 80
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

17) chain C
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

18) chain C
residue 93
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

19) chain C
residue 95
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

20) chain C
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_403

21) chain C
residue 91
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence S
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_403

22) chain C
residue 93
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_403

23) chain C
residue 93
type binding
ligand FUL: BETA-L-FUCOSE
sequence W
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_407


Display surface

Download
Links