eF-site ID 4jzj-ABCDHL
PDB Code 4jzj
Chain A, B, C, D, H, L

click to enlarge
Title Crystal Structure of Receptor-Fab Complex
Classification CYTOKINE RECEPTOR/IMMUNE SYSTEM
Compound Interleukin-3 receptor subunit alpha
Source ORGANISM_COMMON: mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence A:  EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQM
PGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTY
LQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSS
ASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEPK
B:  DIVMTQSPDSLAVSLGERATINCESSQSLLNSGNQKNYLT
WYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQNDYSYPYTFGQGTKLEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC
EVTHQGLSSPVTKSFNRGE
C:  NPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAV
NNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENPWAG
AENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAKRQ
QYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGR
SAAFGIPCTDKFVVFSQIEILTPPNMTAKSFMHWKMRSHF
NRKFRYELQIQVITEQVRDRTSFQLLNPTVQIRARERVYE
FLSAWSTPQR
D:  PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVN
NSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPW
AGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAK
RQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVR
GRSAAFGIPCTDKFVVFSQIEILTPPNMTAKSFMHWKMRS
HFNRKFRYELQIQVITEQVRDRTSFQLYTVQIRARERVYE
FLSAWSTPQRF
H:  EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQM
PGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTY
LQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSS
ASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPK
L:  DIVMTQSPDSLAVSLGERATINCESSQSLLNSGNQKNYLT
WYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQNDYSYPYTFGQGTKLEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC
EVTHQGLSSPVTKSFNRGE
Description (1)  Interleukin-3 receptor subunit alpha, Fab Heavy Chain, Fab Light Chain


Functional site

1) chain D
residue 184
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL D 410
source : AC2

2) chain H
residue 174
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

3) chain H
residue 176
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

4) chain H
residue 184
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

5) chain H
residue 185
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

6) chain H
residue 186
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

7) chain L
residue 168
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

8) chain L
residue 182
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

9) chain L
residue 184
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GOL H 301
source : AC3

10) chain C
residue 46
type
ligand
sequence N
description BINDING SITE FOR MONO-SACCHARIDE NAG C 408 BOUND TO ASN C 46
source : AC4

11) chain C
residue 48
type
ligand
sequence T
description BINDING SITE FOR MONO-SACCHARIDE NAG C 408 BOUND TO ASN C 46
source : AC4

12) chain C
residue 56
type
ligand
sequence A
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

13) chain C
residue 80
type
ligand
sequence N
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

14) chain C
residue 82
type
ligand
sequence T
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

15) chain C
residue 91
type
ligand
sequence S
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

16) chain C
residue 93
type
ligand
sequence W
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

17) chain C
residue 95
type
ligand
sequence L
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

18) chain H
residue 55
type
ligand
sequence N
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

19) chain H
residue 57
type
ligand
sequence A
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

20) chain H
residue 58
type
ligand
sequence T
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

21) chain H
residue 59
type
ligand
sequence F
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

22) chain H
residue 60
type
ligand
sequence Y
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

23) chain H
residue 62
type
ligand
sequence Q
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

24) chain H
residue 65
type
ligand
sequence K
description BINDING SITE FOR CHAIN C OF SUGAR BOUND TO ASN C 80 RESIDUES 401 TO 407
source : AC5

25) chain A
residue 57
type
ligand
sequence A
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

26) chain A
residue 58
type
ligand
sequence T
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

27) chain A
residue 59
type
ligand
sequence F
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

28) chain D
residue 80
type
ligand
sequence N
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

29) chain D
residue 82
type
ligand
sequence T
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

30) chain D
residue 93
type
ligand
sequence W
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

31) chain C
residue 118
type
ligand
sequence D
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

32) chain C
residue 171
type
ligand
sequence R
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

33) chain C
residue 228
type
ligand
sequence R
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

34) chain D
residue 108
type
ligand
sequence E
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

35) chain D
residue 109
type
ligand
sequence N
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

36) chain D
residue 125
type
ligand
sequence A
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 109 RESIDUES 406 TO 408
source : AC7

37) chain C
residue 46-48
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NVT
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_408

38) chain C
residue 53
type binding
ligand FUL: BETA-L-FUCOSE
sequence V
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

39) chain C
residue 56
type binding
ligand FUL: BETA-L-FUCOSE
sequence A
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

40) chain C
residue 82
type binding
ligand FUL: BETA-L-FUCOSE
sequence T
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

41) chain H
residue 58-60
type binding
ligand FUL: BETA-L-FUCOSE
sequence TFY
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

42) chain H
residue 62
type binding
ligand FUL: BETA-L-FUCOSE
sequence Q
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

43) chain H
residue 65
type binding
ligand FUL: BETA-L-FUCOSE
sequence K
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

44) chain L
residue 100
type binding
ligand FUL: BETA-L-FUCOSE
sequence Y
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_402

45) chain C
residue 80
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

46) chain C
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

47) chain C
residue 93
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

48) chain C
residue 95
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

49) chain H
residue 58
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_401

50) chain C
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_403

51) chain C
residue 91
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence S
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_403

52) chain C
residue 93
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_403

53) chain H
residue 56-59
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GATF
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_C_403

54) chain C
residue 93
type binding
ligand FUL: BETA-L-FUCOSE
sequence W
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_C_407

55) chain D
residue 53
type binding
ligand FUL: BETA-L-FUCOSE
sequence V
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

56) chain D
residue 56
type binding
ligand FUL: BETA-L-FUCOSE
sequence A
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

57) chain D
residue 82
type binding
ligand FUL: BETA-L-FUCOSE
sequence T
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

58) chain A
residue 58-60
type binding
ligand FUL: BETA-L-FUCOSE
sequence TFY
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

59) chain A
residue 65
type binding
ligand FUL: BETA-L-FUCOSE
sequence K
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

60) chain D
residue 75
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

61) chain D
residue 96
type binding
ligand GOL: GLYCEROL
sequence F
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

62) chain D
residue 182
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

63) chain D
residue 184
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

64) chain D
residue 194
type binding
ligand GOL: GLYCEROL
sequence C
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_D_410

65) chain D
residue 80
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_401

66) chain D
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_401

67) chain D
residue 93
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_401

68) chain D
residue 95
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_401

69) chain D
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_402

70) chain D
residue 91
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence S
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_402

71) chain D
residue 93
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_402

72) chain A
residue 56-59
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GATF
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_402

73) chain D
residue 93
type binding
ligand FUL: BETA-L-FUCOSE
sequence W
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_405

74) chain D
residue 108-109
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence EN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_407

75) chain D
residue 125-126
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AV
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_407

76) chain D
residue 108
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_4jzj_D_408

77) chain D
residue 128
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence P
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_4jzj_D_408

78) chain D
residue 109
type binding
ligand FUL: BETA-L-FUCOSE
sequence N
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_406

79) chain A
residue 56-58
type binding
ligand BMA: BETA-D-MANNOSE
sequence GAT
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_4jzj_D_403

80) chain H
residue 55-57
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence NGA
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_4jzj_C_405

81) chain H
residue 55-58
type binding
ligand BMA: BETA-D-MANNOSE
sequence NGAT
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_4jzj_C_404

82) chain H
residue 60
type binding
ligand BMA: BETA-D-MANNOSE
sequence Y
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_4jzj_C_404

83) chain H
residue 148
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

84) chain H
residue 173-176
type binding
ligand GOL: GLYCEROL
sequence FPAV
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

85) chain H
residue 184-186
type binding
ligand GOL: GLYCEROL
sequence SLS
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

86) chain L
residue 139
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

87) chain L
residue 166
type binding
ligand GOL: GLYCEROL
sequence Q
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

88) chain L
residue 168
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

89) chain L
residue 182
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301

90) chain L
residue 184
type binding
ligand GOL: GLYCEROL
sequence T
description GLYCEROL binding site
source pdb_hetatom : GOL_4jzj_H_301


Display surface

Download
Links