eF-site ID 4jzj-A
PDB Code 4jzj
Chain A

click to enlarge
Title Crystal Structure of Receptor-Fab Complex
Classification CYTOKINE RECEPTOR/IMMUNE SYSTEM
Compound Interleukin-3 receptor subunit alpha
Source ORGANISM_COMMON: mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence A:  EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQM
PGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTY
LQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSS
ASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEPK
Description (1)  Interleukin-3 receptor subunit alpha, Fab Heavy Chain, Fab Light Chain


Functional site

1) chain A
residue 57
type
ligand
sequence A
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

2) chain A
residue 58
type
ligand
sequence T
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

3) chain A
residue 59
type
ligand
sequence F
description BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 80 RESIDUES 401 TO 405
source : AC6

4) chain A
residue 58-60
type binding
ligand FUL: BETA-L-FUCOSE
sequence TFY
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

5) chain A
residue 65
type binding
ligand FUL: BETA-L-FUCOSE
sequence K
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_4jzj_D_404

6) chain A
residue 56-59
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GATF
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4jzj_D_402

7) chain A
residue 56-58
type binding
ligand BMA: BETA-D-MANNOSE
sequence GAT
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_4jzj_D_403


Display surface

Download
Links