eF-site ID 4jve-A PDB Code 4jve Chain A click to enlarge Title Co-crystal structure of MDM2 with inhibitor (2R,3E)-2-[(2S,3R,6S)-2,3-bis(4-chlorophenyl)-6-(4-fluorobenzyl)-5-oxomorpholin-4-yl]pent-3-enoic acid Classification LIGASE/LIGASE INHIBITOR Compound E3 ubiquitin-protein ligase Mdm2 Source Homo sapiens (Human) (MDM2_HUMAN) Sequence A:  QIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYL GQYIMTKRLYDEKQQHIVYCSNDLLGDLGVPSFSVKEHRK IYTMIYRNLVVV Description (1)  E3 ubiquitin-protein ligase Mdm2 (E.C.6.3.2.-) Functional site 1) chain A residue 29 type sequence R description BINDING SITE FOR RESIDUE 1MQ A 201 source : AC1 2) chain A residue 54 type sequence L description BINDING SITE FOR RESIDUE 1MQ A 201 source : AC1 3) chain A residue 55 type sequence F description BINDING SITE FOR RESIDUE 1MQ A 201 source : AC1 4) chain A residue 57 type sequence L description BINDING SITE FOR RESIDUE 1MQ A 201 source : AC1 5) chain A residue 58 type sequence G description BINDING SITE FOR RESIDUE 1MQ A 201 source : AC1 6) chain A residue 59 type sequence Q description BINDING SITE FOR RESIDUE 1MQ A 201 source : AC1 7) chain A residue 62 type sequence M description BINDING SITE FOR RESIDUE 1MQ A 201 source : AC1 8) chain A residue 99 type sequence I description BINDING SITE FOR RESIDUE 1MQ A 201 source : AC1

Display surface Download Links