eF-site ID 4jse-A PDB Code 4jse Chain A click to enlarge Title Structure of rat neuronal nitric oxide synthase heme domain in complex with 6,6'-(pentane-1,5-diyl)bis(4-methylpyridin-2-amine) Classification OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR Compound Nitric oxide synthase, brain Source Rattus norvegicus (Rat) (NOS1_RAT) Sequence A:  RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLP STKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEI ESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFD ARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDG KHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQ GWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRH PKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWY MGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQ ALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRC RGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQP DPWNTHVW Description Functional site 1) chain A residue 409 type sequence W description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 2) chain A residue 414 type sequence R description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 3) chain A residue 415 type sequence C description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 4) chain A residue 416 type sequence V description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 5) chain A residue 457 type sequence S description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 6) chain A residue 584 type sequence F description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 7) chain A residue 585 type sequence S description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 8) chain A residue 586 type sequence G description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 9) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 10) chain A residue 589 type sequence M description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 11) chain A residue 592 type sequence E description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 12) chain A residue 678 type sequence W description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 13) chain A residue 706 type sequence Y description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 14) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE ACT A 802 source : AC2 15) chain A residue 657 type sequence S description BINDING SITE FOR RESIDUE ACT A 802 source : AC2 16) chain A residue 323 type sequence E description BINDING SITE FOR RESIDUE QJ2 A 803 source : AC3 17) chain A residue 573 type sequence E description BINDING SITE FOR RESIDUE QJ2 A 803 source : AC3 18) chain A residue 578 type sequence E description BINDING SITE FOR RESIDUE QJ2 A 803 source : AC3 19) chain A residue 699 type sequence R description BINDING SITE FOR RESIDUE QJ2 A 803 source : AC3 20) chain A residue 704 type sequence F description BINDING SITE FOR RESIDUE QJ2 A 803 source : AC3 21) chain A residue 705 type sequence E description BINDING SITE FOR RESIDUE QJ2 A 803 source : AC3 22) chain A residue 706 type sequence Y description BINDING SITE FOR RESIDUE QJ2 A 803 source : AC3 23) chain A residue 334 type sequence S description BINDING SITE FOR RESIDUE H4B A 804 source : AC4 24) chain A residue 336 type sequence M description BINDING SITE FOR RESIDUE H4B A 804 source : AC4 25) chain A residue 596 type sequence R description BINDING SITE FOR RESIDUE H4B A 804 source : AC4 26) chain A residue 677 type sequence V description BINDING SITE FOR RESIDUE H4B A 804 source : AC4 27) chain A residue 678 type sequence W description BINDING SITE FOR RESIDUE H4B A 804 source : AC4 28) chain A residue 477 type sequence S description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 29) chain A residue 478 type sequence Q description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 30) chain A residue 481 type sequence R description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 31) chain A residue 567 type sequence V description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 32) chain A residue 569 type sequence N description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 33) chain A residue 570 type sequence M description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 34) chain A residue 584 type sequence F description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 35) chain A residue 586 type sequence G description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 36) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 37) chain A residue 592 type sequence E description BINDING SITE FOR RESIDUE QJ2 A 805 source : AC5 38) chain A residue 596 type sequence R description BINDING SITE FOR RESIDUE ZN A 806 source : AC6 39) chain A residue 600 type sequence D description BINDING SITE FOR RESIDUE ZN A 806 source : AC6 40) chain A residue 596 type sequence R description BINDING SITE FOR RESIDUE CL A 807 source : AC7 41) chain A residue 600 type sequence D description BINDING SITE FOR RESIDUE CL A 807 source : AC7 42) chain A residue 596 type sequence R description BINDING SITE FOR RESIDUE CL A 808 source : AC8 43) chain A residue 600 type sequence D description BINDING SITE FOR RESIDUE CL A 808 source : AC8 44) chain A residue 326 type sequence C description BINDING SITE FOR RESIDUE ZN A 809 source : AC9 45) chain A residue 331 type sequence C description BINDING SITE FOR RESIDUE ZN A 809 source : AC9 46) chain A residue 676 type sequence W description BINDING SITE FOR RESIDUE H4B B 802 source : BC2 47) chain A residue 691 type sequence F description BINDING SITE FOR RESIDUE H4B B 802 source : BC2 48) chain A residue 692 type sequence H description BINDING SITE FOR RESIDUE H4B B 802 source : BC2 49) chain A residue 693 type sequence Q description BINDING SITE FOR RESIDUE H4B B 802 source : BC2 50) chain A residue 694 type sequence E description BINDING SITE FOR RESIDUE H4B B 802 source : BC2 51) chain A residue 692 type sequence H description BINDING SITE FOR RESIDUE ZN B 806 source : BC6 52) chain A residue 686 type sequence S description BINDING SITE FOR RESIDUE CL B 808 source : BC8 53) chain A residue 334 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 54) chain A residue 478 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 55) chain A residue 587 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 56) chain A residue 588 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 57) chain A residue 592 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 58) chain A residue 677 type BINDING sequence V description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 59) chain A residue 678 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 60) chain A residue 691 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 61) chain A residue 706 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 62) chain A residue 415 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI2 63) chain A residue 414-421 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001

Display surface Download Links