eF-site ID 4jls-J PDB Code 4jls Chain J click to enlarge Title Crystal Structure of E. coli XGPRT in complex with (3R,4S)-4-(Guanin-9-yl)-3-hydroxypyrrolidin-1-N-ylacetylphosphonic acid Classification TRANSFERASE Compound Xanthine phosphoribosyltransferase Source Escherichia coli str. K-12 substr. MDS42 (H0Q6L9_ECOLI) Sequence J:  EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP GALLARELGIRHVDTVCISSYDGEGFIVIDDLVDTGGTAV AIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQP WDMGVVFVPPISGR Description Functional site 1) chain J residue 90 type sequence L description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 2) chain J residue 91 type sequence V description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 3) chain J residue 92 type sequence D description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 4) chain J residue 93 type sequence T description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 5) chain J residue 94 type sequence G description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 6) chain J residue 95 type sequence G description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 7) chain J residue 96 type sequence T description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 8) chain J residue 115 type sequence K description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 9) chain J residue 133 type sequence T description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 10) chain J residue 134 type sequence W description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 11) chain J residue 135 type sequence I description BINDING SITE FOR RESIDUE 3ZE J 201 source : AC8 12) chain J residue 37 type BINDING sequence R description BINDING => ECO:0000305|PubMed:9743633, ECO:0007744|PDB:1A95 source Swiss-Prot : SWS_FT_FI1 13) chain J residue 88 type BINDING sequence D description BINDING => ECO:0000305|PubMed:9743633, ECO:0007744|PDB:1A95 source Swiss-Prot : SWS_FT_FI1 14) chain J residue 134 type BINDING sequence W description BINDING => ECO:0000269|PubMed:9743633, ECO:0007744|PDB:1A97 source Swiss-Prot : SWS_FT_FI2 15) chain J residue 89 type BINDING sequence D description BINDING => ECO:0000269|PubMed:9100006 source Swiss-Prot : SWS_FT_FI3 16) chain J residue 92 type BINDING sequence D description BINDING => ECO:0000269|PubMed:9743633, ECO:0007744|PDB:1A96 source Swiss-Prot : SWS_FT_FI4 17) chain J residue 135 type BINDING sequence I description BINDING => ECO:0000269|PubMed:9743633, ECO:0007744|PDB:1A96 source Swiss-Prot : SWS_FT_FI4 18) chain J residue 88 type catalytic sequence D description 391 source MCSA : MCSA8 19) chain J residue 89 type catalytic sequence D description 391 source MCSA : MCSA8 20) chain J residue 92 type catalytic sequence D description 391 source MCSA : MCSA8

Display surface Download Links