eF-site ID 4jhc-A PDB Code 4jhc Chain A click to enlarge Title Crystal structure of the uncharacterized Maf protein YceF from E. coli Classification CELL CYCLE Compound Maf-like protein YceF Source Escherichia coli (strain K12) (YCEF_ECOLI) Sequence A:  PKLILASTSPWRRALLEKLQISFECAAPEVDETPRSDESP RQLVLRLAQEKAQSLASRYPDHLIIGSDQVCVLDGEITGK PLTEENARLQLRKASGNIVTFYTGLALFNSANGHLQTEVE PFDVHFRHLSEAEIDNYVRKEHPLHCAGSFKSEGFGITLF ERLEGRDPNTLVGLPLIALCQMLRREGKNPLM Description Functional site 1) chain A residue 8 type sequence S description BINDING SITE FOR RESIDUE GOL A 3001 source : AC1 2) chain A residue 9 type sequence T description BINDING SITE FOR RESIDUE GOL A 3001 source : AC1 3) chain A residue 10 type sequence S description BINDING SITE FOR RESIDUE GOL A 3001 source : AC1 4) chain A residue 13 type sequence R description BINDING SITE FOR RESIDUE GOL A 3001 source : AC1 5) chain A residue 29 type sequence P description BINDING SITE FOR RESIDUE GOL A 3001 source : AC1 6) chain A residue 52 type sequence K description BINDING SITE FOR RESIDUE GOL A 3001 source : AC1 7) chain A residue 68 type sequence S description BINDING SITE FOR RESIDUE GOL A 3001 source : AC1 8) chain A residue 93 type sequence R description BINDING SITE FOR RESIDUE GOL B 201 source : AC2 9) chain A residue 69 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|HAMAP-Rule:MF_00528, ECO:0000305|PubMed:24210219 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 12 type SITE sequence W description Important for substrate specificity => ECO:0000255|HAMAP-Rule:MF_00528, ECO:0000305|PubMed:24210219 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 70 type SITE sequence Q description Important for substrate specificity => ECO:0000255|HAMAP-Rule:MF_00528, ECO:0000305|PubMed:24210219 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 154 type SITE sequence E description Important for substrate specificity => ECO:0000255|HAMAP-Rule:MF_00528, ECO:0000305|PubMed:24210219 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links