eF-site ID 4jdv-A PDB Code 4jdv Chain A click to enlarge Title Crystal structure of germ-line precursor of NIH45-46 Fab Classification IMMUNE SYSTEM Compound Fab heavy chain Source (4JDV) Sequence A:  VQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAP GQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYM ELSRLRSDDTAVYYCARGKYCTARDYYNWDFQHWGQGTLV TVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT YICNVNHKPSNTKVDKRVEPKSCDKTH Description Functional site 1) chain A residue 82 type sequence L description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 2) chain A residue 83 type sequence R description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 3) chain A residue 7 type sequence S description BINDING SITE FOR RESIDUE SO4 A 302 source : AC2 4) chain A residue 8 type sequence G description BINDING SITE FOR RESIDUE SO4 A 302 source : AC2 5) chain A residue 170 type sequence F description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 6) chain A residue 171 type sequence P description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 7) chain A residue 181 type sequence S description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 8) chain A residue 182 type sequence L description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 9) chain A residue 183 type sequence S description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 10) chain A residue 152 type sequence E description BINDING SITE FOR RESIDUE 144 A 304 source : AC4 11) chain A residue 153 type sequence P description BINDING SITE FOR RESIDUE 144 A 304 source : AC4 12) chain A residue 154 type sequence V description BINDING SITE FOR RESIDUE 144 A 304 source : AC4 13) chain A residue 170 type sequence F description BINDING SITE FOR RESIDUE 144 A 304 source : AC4 14) chain A residue 172 type sequence A description BINDING SITE FOR RESIDUE 144 A 304 source : AC4 15) chain A residue 182 type sequence L description BINDING SITE FOR RESIDUE 144 A 304 source : AC4 16) chain A residue 168 type sequence H description BINDING SITE FOR RESIDUE GOL B 302 source : AC6 17) chain A residue 61 type sequence Q description BINDING SITE FOR RESIDUE 1PE H 302 source : AC8 18) chain A residue 138 type sequence G description BINDING SITE FOR RESIDUE 1PE L 302 source : BC1 19) chain A residue 139 type sequence T description BINDING SITE FOR RESIDUE 1PE L 302 source : BC1 20) chain A residue 188 type sequence V description BINDING SITE FOR RESIDUE 1PE L 302 source : BC1 21) chain A residue 189 type sequence P description BINDING SITE FOR RESIDUE 1PE L 302 source : BC1 22) chain A residue 198-204 type prosite sequence YICNVNH description IG_MHC Immunoglobulins and major histocompatibility complex proteins signature. YICNVNH source prosite : PS00290

Display surface Download Links