eF-site ID 4j8x-H PDB Code 4j8x Chain H click to enlarge Title X-ray structure of NCP145 with bound chlorido(eta-6-p-cymene)(N-fluorophenyl-2-pyridinecarbothioamide)ruthenium(II) Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.2 Source Xenopus laevis (African clawed frog) (4J8X) Sequence H:  KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVF ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA VSEGTKAVTKYTSAK Description Functional site 1) chain H residue 67 type sequence F description BINDING SITE FOR RESIDUE RU7 D 1102 source : AC2 2) chain H residue 68 type sequence E description BINDING SITE FOR RESIDUE RU7 D 1102 source : AC2 3) chain H residue 87 type sequence T description BINDING SITE FOR RESIDUE SO4 H 201 source : AC4 4) chain H residue 88 type sequence S description BINDING SITE FOR RESIDUE SO4 H 201 source : AC4 5) chain H residue 46 type sequence H description BINDING SITE FOR RESIDUE SO4 H 202 source : AC5 6) chain H residue 47 type sequence P description BINDING SITE FOR RESIDUE SO4 H 202 source : AC5 7) chain H residue 48 type sequence D description BINDING SITE FOR RESIDUE SO4 H 202 source : AC5 8) chain H residue 49 type sequence T description BINDING SITE FOR RESIDUE SO4 H 202 source : AC5 9) chain H residue 79 type sequence H description BINDING SITE FOR RESIDUE RU7 H 203 source : AC6 10) chain H residue 117 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links