eF-site ID 4j8x-C PDB Code 4j8x Chain C click to enlarge Title X-ray structure of NCP145 with bound chlorido(eta-6-p-cymene)(N-fluorophenyl-2-pyridinecarbothioamide)ruthenium(II) Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.2 Source Xenopus laevis (African clawed frog) (4J8X) Sequence C:  AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAA VLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL NKLLGRVTIAQGGVLPNIQSVLLPKK Description Functional site 1) chain C residue 44 type sequence G description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC1 2) chain C residue 45 type sequence A description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC1 3) chain C residue 46 type sequence G description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC1 4) chain C residue 47 type sequence A description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC1 5) chain C residue 36 type sequence K description BINDING SITE FOR RESIDUE RU7 H 203 source : AC6 6) chain C residue 39 type sequence Y description BINDING SITE FOR RESIDUE RU7 H 203 source : AC6 7) chain C residue 21-27 type prosite sequence AGLQFPV description HISTONE_H2A Histone H2A signature. AGLqFPV source prosite : PS00046 8) chain C residue 95 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI3 9) chain C residue 36 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI4 10) chain C residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 11) chain C residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 12) chain C residue 104 type MOD_RES sequence Q description N5-methylglutamine => ECO:0000250 source Swiss-Prot : SWS_FT_FI6 13) chain C residue 118 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI7 14) chain C residue 15 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250 source Swiss-Prot : SWS_FT_FI8 15) chain C residue 119 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links