eF-site ID 4j8u-C PDB Code 4j8u Chain C click to enlarge Title X-ray structure of NCP145 with chlorido(eta-6-p-cymene)(N-phenyl-2-pyridinecarbothioamide)osmium(II) Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.2 Source (4J8U) Sequence C:  AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAA VLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL NKLLGRVTIAQGGVLPNIQSVLLPKK Description Functional site 1) chain C residue 44 type sequence G description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC1 2) chain C residue 46 type sequence G description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC1 3) chain C residue 47 type sequence A description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC1 4) chain C residue 36 type sequence K description BINDING SITE FOR RESIDUE ELJ H 204 source : AC7 5) chain C residue 37 type sequence G description BINDING SITE FOR RESIDUE ELJ H 204 source : AC7 6) chain C residue 39 type sequence Y description BINDING SITE FOR RESIDUE ELJ H 204 source : AC7 7) chain C residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 8) chain C residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 9) chain C residue 104 type MOD_RES sequence Q description N5-methylglutamine => ECO:0000250 source Swiss-Prot : SWS_FT_FI6 10) chain C residue 118 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI7 11) chain C residue 15 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250 source Swiss-Prot : SWS_FT_FI8 12) chain C residue 119 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250 source Swiss-Prot : SWS_FT_FI8 13) chain C residue 21-27 type prosite sequence AGLQFPV description HISTONE_H2A Histone H2A signature. AGLqFPV source prosite : PS00046

Display surface Download Links