eF-site ID 4j8u-H PDB Code 4j8u Chain H click to enlarge Title X-ray structure of NCP145 with chlorido(eta-6-p-cymene)(N-phenyl-2-pyridinecarbothioamide)osmium(II) Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.2 Source (4J8U) Sequence H:  KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVF ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA VSEGTKAVTKYTSAK Description Functional site 1) chain H residue 31 type sequence K description BINDING SITE FOR RESIDUE ELJ D 1102 source : AC2 2) chain H residue 68 type sequence E description BINDING SITE FOR RESIDUE ELJ D 1102 source : AC2 3) chain H residue 87 type sequence T description BINDING SITE FOR RESIDUE SO4 H 201 source : AC4 4) chain H residue 88 type sequence S description BINDING SITE FOR RESIDUE SO4 H 201 source : AC4 5) chain H residue 46 type sequence H description BINDING SITE FOR RESIDUE SO4 H 202 source : AC5 6) chain H residue 47 type sequence P description BINDING SITE FOR RESIDUE SO4 H 202 source : AC5 7) chain H residue 48 type sequence D description BINDING SITE FOR RESIDUE SO4 H 202 source : AC5 8) chain H residue 49 type sequence T description BINDING SITE FOR RESIDUE SO4 H 202 source : AC5 9) chain H residue 102 type sequence E description BINDING SITE FOR RESIDUE ELJ H 203 source : AC6 10) chain H residue 106 type sequence H description BINDING SITE FOR RESIDUE ELJ H 203 source : AC6 11) chain H residue 79 type sequence H description BINDING SITE FOR RESIDUE ELJ H 204 source : AC7 12) chain H residue 109 type CARBOHYD sequence S description O-linked (GlcNAc) serine => ECO:0000250|UniProtKB:P62807 source Swiss-Prot : SWS_FT_FI3 13) chain H residue 117 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P0C1H4 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links