eF-site ID 4j8u-G PDB Code 4j8u Chain G click to enlarge Title X-ray structure of NCP145 with chlorido(eta-6-p-cymene)(N-phenyl-2-pyridinecarbothioamide)osmium(II) Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.2 Source (4J8U) Sequence G:  AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAA VLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL NKLLGRVTIAQGGVLPNIQSVLLPKK Description Functional site 1) chain G residue 37 type sequence G description BINDING SITE FOR RESIDUE ELJ D 1102 source : AC2 2) chain G residue 39 type sequence Y description BINDING SITE FOR RESIDUE ELJ D 1102 source : AC2 3) chain G residue 44 type sequence G description BINDING SITE FOR RESIDUE SO4 H 201 source : AC4 4) chain G residue 45 type sequence A description BINDING SITE FOR RESIDUE SO4 H 201 source : AC4 5) chain G residue 46 type sequence G description BINDING SITE FOR RESIDUE SO4 H 201 source : AC4 6) chain G residue 47 type sequence A description BINDING SITE FOR RESIDUE SO4 H 201 source : AC4 7) chain G residue 57 type sequence Y description BINDING SITE FOR RESIDUE ELJ H 203 source : AC6 8) chain G residue 61 type sequence E description BINDING SITE FOR RESIDUE ELJ H 203 source : AC6 9) chain G residue 92 type sequence E description BINDING SITE FOR RESIDUE ELJ H 203 source : AC6 10) chain G residue 95 type CARBOHYD sequence K description O-linked (GlcNAc) serine => ECO:0000250|UniProtKB:P62807 source Swiss-Prot : SWS_FT_FI3 11) chain G residue 36 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P0C1H4 source Swiss-Prot : SWS_FT_FI4 12) chain G residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 13) chain G residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 14) chain G residue 104 type MOD_RES sequence Q description N5-methylglutamine => ECO:0000250 source Swiss-Prot : SWS_FT_FI6 15) chain G residue 118 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI7 16) chain G residue 15 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250 source Swiss-Prot : SWS_FT_FI8 17) chain G residue 119 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links