eF-site ID 4j89-AB PDB Code 4j89 Chain A, B click to enlarge Title Different photochemical events of a genetically encoded aryl azide define and modulate GFP fluorescence Classification FLUORESCENT PROTEIN Compound Green fluorescent protein Source Aequorea victoria (Jellyfish) (GFP_AEQVI) Sequence A:  VSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNG KLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKRHD FFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNR IELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIK ANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS TQSVLSKDPNEKRDHMVLLEFVTAAGITH B:  SKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGK LTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKRHDF FKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRI ELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKA NFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLST QSVLSKDPNEKRDHMVLLEFVTAAGIT Description Functional site 1) chain A residue 80 type sequence R description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 2) chain A residue 116 type sequence G description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 3) chain A residue 117 type sequence D description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 4) chain A residue 118 type sequence T description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 5) chain A residue 55 type sequence V description BINDING SITE FOR RESIDUE SO4 A 302 source : AC2 6) chain A residue 56 type sequence P description BINDING SITE FOR RESIDUE SO4 A 302 source : AC2 7) chain A residue 57 type sequence W description BINDING SITE FOR RESIDUE SO4 A 302 source : AC2 8) chain A residue 58 type sequence P description BINDING SITE FOR RESIDUE SO4 A 302 source : AC2 9) chain A residue 139 type sequence H description BINDING SITE FOR RESIDUE SO4 A 302 source : AC2 10) chain A residue 73 type sequence R description BINDING SITE FOR RESIDUE TRS A 303 source : AC3 11) chain A residue 75 type sequence P description BINDING SITE FOR RESIDUE TRS A 303 source : AC3 12) chain A residue 76 type sequence D description BINDING SITE FOR RESIDUE TRS A 303 source : AC3 13) chain A residue 77 type sequence H description BINDING SITE FOR RESIDUE TRS A 303 source : AC3 14) chain B residue 149 type sequence N description BINDING SITE FOR RESIDUE TRS A 303 source : AC3 15) chain B residue 151 type sequence Y description BINDING SITE FOR RESIDUE TRS A 303 source : AC3 16) chain A residue 95 type sequence E description BINDING SITE FOR RESIDUE EDO A 304 source : AC4 17) chain A residue 109 type sequence R description BINDING SITE FOR RESIDUE EDO A 304 source : AC4 18) chain B residue 3 type sequence K description BINDING SITE FOR RESIDUE EDO A 304 source : AC4 19) chain A residue 124 type sequence E description BINDING SITE FOR RESIDUE EDO A 305 source : AC5 20) chain B residue 194 type sequence L description BINDING SITE FOR RESIDUE EDO A 305 source : AC5 21) chain A residue 109 type sequence R description BINDING SITE FOR RESIDUE EDO A 306 source : AC6 22) chain A residue 124 type sequence E description BINDING SITE FOR RESIDUE EDO A 306 source : AC6 23) chain A residue 30 type sequence R description BINDING SITE FOR RESIDUE EDO A 307 source : AC7 24) chain A residue 143 type sequence Y description BINDING SITE FOR RESIDUE EDO A 308 source : AC8 25) chain A residue 208 type sequence S description BINDING SITE FOR RESIDUE EDO A 308 source : AC8 26) chain A residue 209 type sequence K description BINDING SITE FOR RESIDUE EDO A 308 source : AC8 27) chain A residue 143 type sequence Y description BINDING SITE FOR RESIDUE EDO A 309 source : AC9 28) chain A residue 144 type sequence N description BINDING SITE FOR RESIDUE EDO A 309 source : AC9 29) chain A residue 205 type sequence S description BINDING SITE FOR RESIDUE EDO A 309 source : AC9 30) chain A residue 206 type sequence V description BINDING SITE FOR RESIDUE EDO A 309 source : AC9 31) chain A residue 207 type sequence L description BINDING SITE FOR RESIDUE EDO A 309 source : AC9 32) chain A residue 90 type sequence E description BINDING SITE FOR RESIDUE EDO A 310 source : BC1 33) chain A residue 113 type sequence K description BINDING SITE FOR RESIDUE EDO A 310 source : BC1 34) chain A residue 188 type sequence I description BINDING SITE FOR RESIDUE EDO A 310 source : BC1 35) chain A residue 132 type sequence E description BINDING SITE FOR RESIDUE EDO A 311 source : BC2 36) chain A residue 149 type sequence N description BINDING SITE FOR RESIDUE EDO A 312 source : BC3 37) chain A residue 151 type sequence Y description BINDING SITE FOR RESIDUE EDO A 312 source : BC3 38) chain B residue 75 type sequence P description BINDING SITE FOR RESIDUE EDO A 312 source : BC3 39) chain B residue 76 type sequence D description BINDING SITE FOR RESIDUE EDO A 312 source : BC3 40) chain A residue 102 type sequence D description BINDING SITE FOR RESIDUE EDO A 313 source : BC4 41) chain A residue 103 type sequence D description BINDING SITE FOR RESIDUE EDO A 313 source : BC4 42) chain A residue 144 type sequence N description BINDING SITE FOR RESIDUE EDO A 314 source : BC5 43) chain A residue 190 type sequence D description BINDING SITE FOR RESIDUE EDO A 315 source : BC6 44) chain B residue 56 type sequence P description BINDING SITE FOR RESIDUE EDO A 315 source : BC6 45) chain B residue 57 type sequence W description BINDING SITE FOR RESIDUE EDO A 315 source : BC6 46) chain B residue 58 type sequence P description BINDING SITE FOR RESIDUE EDO A 315 source : BC6 47) chain B residue 139 type sequence H description BINDING SITE FOR RESIDUE EDO A 315 source : BC6 48) chain A residue 148 type sequence H description BINDING SITE FOR RESIDUE EDO A 316 source : BC7 49) chain A residue 165 type sequence F description BINDING SITE FOR RESIDUE EDO A 316 source : BC7 50) chain A residue 166 type sequence K description BINDING SITE FOR RESIDUE EDO A 316 source : BC7 51) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE EDO A 316 source : BC7 52) chain B residue 101 type sequence K description BINDING SITE FOR RESIDUE SO4 B 301 source : BC8 53) chain B residue 102 type sequence D description BINDING SITE FOR RESIDUE SO4 B 301 source : BC8 54) chain B residue 103 type sequence D description BINDING SITE FOR RESIDUE SO4 B 301 source : BC8 55) chain B residue 148 type sequence H description BINDING SITE FOR RESIDUE SO4 B 302 source : BC9 56) chain B residue 165 type sequence F description BINDING SITE FOR RESIDUE SO4 B 302 source : BC9 57) chain B residue 166 type sequence K description BINDING SITE FOR RESIDUE SO4 B 302 source : BC9 58) chain A residue 41 type sequence K description BINDING SITE FOR RESIDUE SO4 B 303 source : CC1 59) chain B residue 144 type sequence N description BINDING SITE FOR RESIDUE SO4 B 303 source : CC1 60) chain B residue 145 type sequence F description BINDING SITE FOR RESIDUE SO4 B 303 source : CC1 61) chain B residue 205 type sequence S description BINDING SITE FOR RESIDUE SO4 B 303 source : CC1 62) chain B residue 206 type sequence V description BINDING SITE FOR RESIDUE SO4 B 303 source : CC1 63) chain B residue 207 type sequence L description BINDING SITE FOR RESIDUE SO4 B 303 source : CC1 64) chain A residue 107 type sequence K description BINDING SITE FOR RESIDUE EDO B 304 source : CC2 65) chain A residue 126 type sequence K description BINDING SITE FOR RESIDUE EDO B 304 source : CC2 66) chain B residue 194 type sequence L description BINDING SITE FOR RESIDUE EDO B 304 source : CC2 67) chain B residue 195 type sequence L description BINDING SITE FOR RESIDUE EDO B 304 source : CC2 68) chain A residue 89 type sequence P description BINDING SITE FOR RESIDUE EDO B 305 source : CC3 69) chain A residue 90 type sequence E description BINDING SITE FOR RESIDUE EDO B 305 source : CC3 70) chain B residue 143 type sequence Y description BINDING SITE FOR RESIDUE EDO B 305 source : CC3 71) chain B residue 208 type sequence S description BINDING SITE FOR RESIDUE EDO B 305 source : CC3 72) chain B residue 209 type sequence K description BINDING SITE FOR RESIDUE EDO B 305 source : CC3 73) chain B residue 17 type sequence E description BINDING SITE FOR RESIDUE EDO B 306 source : CC4 74) chain B residue 29 type sequence V description BINDING SITE FOR RESIDUE EDO B 306 source : CC4 75) chain B residue 30 type sequence R description BINDING SITE FOR RESIDUE EDO B 306 source : CC4 76) chain B residue 208 type sequence S description BINDING SITE FOR RESIDUE EDO B 307 source : CC5 77) chain B residue 209 type sequence K description BINDING SITE FOR RESIDUE EDO B 307 source : CC5 78) chain A residue 200 type sequence Y description BINDING SITE FOR RESIDUE EDO B 308 source : CC6 79) chain A residue 228 type sequence G description BINDING SITE FOR RESIDUE EDO B 308 source : CC6 80) chain A residue 229 type sequence I description BINDING SITE FOR RESIDUE EDO B 308 source : CC6 81) chain B residue 77 type sequence H description BINDING SITE FOR RESIDUE EDO B 308 source : CC6 82) chain B residue 227 type sequence A description BINDING SITE FOR RESIDUE EDO B 308 source : CC6 83) chain B residue 228 type sequence G description BINDING SITE FOR RESIDUE EDO B 308 source : CC6 84) chain B residue 229 type sequence I description BINDING SITE FOR RESIDUE EDO B 308 source : CC6 85) chain B residue 164 type sequence N description BINDING SITE FOR RESIDUE EDO B 309 source : CC7 86) chain B residue 34 type sequence E description BINDING SITE FOR RESIDUE EDO B 310 source : CC8 87) chain B residue 36 type sequence D description BINDING SITE FOR RESIDUE EDO B 310 source : CC8 88) chain B residue 41 type sequence K description BINDING SITE FOR RESIDUE EDO B 310 source : CC8 89) chain B residue 42 type sequence L description BINDING SITE FOR RESIDUE EDO B 310 source : CC8 90) chain B residue 43 type sequence T description BINDING SITE FOR RESIDUE EDO B 310 source : CC8 91) chain B residue 151 type sequence Y description BINDING SITE FOR RESIDUE EDO B 311 source : CC9 92) chain B residue 152 type sequence I description BINDING SITE FOR RESIDUE EDO B 311 source : CC9 93) chain B residue 198 type sequence N description BINDING SITE FOR RESIDUE EDO B 311 source : CC9 94) chain B residue 199 type sequence H description BINDING SITE FOR RESIDUE EDO B 311 source : CC9 95) chain B residue 228 type sequence G description BINDING SITE FOR RESIDUE EDO B 311 source : CC9 96) chain B residue 166 type sequence K description BINDING SITE FOR RESIDUE EDO B 312 source : DC1 97) chain B residue 80 type sequence R description BINDING SITE FOR RESIDUE EDO B 313 source : DC2 98) chain B residue 194 type sequence L description BINDING SITE FOR RESIDUE EDO B 313 source : DC2 99) chain B residue 195 type sequence L description BINDING SITE FOR RESIDUE EDO B 313 source : DC2 100) chain A residue 68 type MOD_RES sequence V description (Z)-2,3-didehydrotyrosine => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI1 101) chain B residue 68 type MOD_RES sequence V description (Z)-2,3-didehydrotyrosine => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI1 102) chain A residue 66 type CROSSLNK sequence X description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2 103) chain A residue 69 type CROSSLNK sequence Q description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2 104) chain B residue 66 type CROSSLNK sequence X description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2 105) chain B residue 69 type CROSSLNK sequence Q description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links