eF-site ID 4j0u-A PDB Code 4j0u Chain A click to enlarge Title Crystal structure of IFIT5/ISG58 Classification RNA BINDING PROTEIN Compound Interferon-induced protein with tetratricopeptide repeats 5 Source Homo sapiens (Human) (IFIT5_HUMAN) Sequence A:  MSEIRKDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQ QLEFLKSRLALYNLLAYVKHLKGQNKDALECLEQAEEIIQ QEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGN VCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKAKAA FEKALEVEPDNPEFNIGYAITVYRLDDVKSFSLGPLRKAV TLNPDNSYIKVFLALKLQDVHAEAEGEKYIEEILDQISSQ PYVLRYAAKFYRRKNSWNKALELLKKALEVTPTSSFLHHQ MGLCYRAQMIQIKKATHNRPKGKDKLKVDELISSAIFHFK AAMERDSMFAFAYTDLANMYAEGGQYSNAEDIFRKALRLE NITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKD RSPLRTKLTSALKKLSTKRLCHNALDQSLSALGFVYKLEG EKRQAAEYYEKAQKIDPENAEFLTALCELRL Description (1)  Interferon-induced protein with tetratricopeptide repeats 5 Functional site 1) chain A residue 33 type SITE sequence E description Interaction with PPP-RNA source Swiss-Prot : SWS_FT_FI1 2) chain A residue 37 type SITE sequence T description Interaction with PPP-RNA source Swiss-Prot : SWS_FT_FI1 3) chain A residue 41 type SITE sequence Q description Interaction with PPP-RNA source Swiss-Prot : SWS_FT_FI1 4) chain A residue 150 type SITE sequence K description Interaction with PPP-RNA source Swiss-Prot : SWS_FT_FI1 5) chain A residue 186 type SITE sequence R description Interaction with PPP-RNA source Swiss-Prot : SWS_FT_FI1 6) chain A residue 250 type SITE sequence Y description Interaction with PPP-RNA source Swiss-Prot : SWS_FT_FI1 7) chain A residue 288 type SITE sequence Q description Interaction with the 5'-triphosphate group of PPP-RNA source Swiss-Prot : SWS_FT_FI2

Display surface Download Links