eF-site ID 4ixr-x PDB Code 4ixr Chain x click to enlarge Title RT fs X-ray diffraction of Photosystem II, first illuminated state Classification PHOTOSYNTHESIS Compound Photosystem Q(B) protein 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence x:  TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQ Description Functional site 1) chain x residue 22 type sequence G description BINDING SITE FOR RESIDUE CLA d 403 source : RC8 2) chain x residue 23 type sequence L description BINDING SITE FOR RESIDUE CLA d 403 source : RC8 3) chain x residue 26 type sequence G description BINDING SITE FOR RESIDUE CLA d 403 source : RC8 4) chain x residue 34 type sequence F description BINDING SITE FOR RESIDUE SQD d 408 source : SC4 5) chain x residue 21 type sequence I description BINDING SITE FOR RESIDUE LMT d 410 source : SC6 6) chain x residue 25 type sequence S description BINDING SITE FOR RESIDUE LMT d 410 source : SC6 7) chain x residue 26 type sequence G description BINDING SITE FOR RESIDUE LMT d 410 source : SC6 8) chain x residue 33 type sequence T description BINDING SITE FOR RESIDUE SQD f 102 source : SC9 9) chain x residue 44 type sequence D description BINDING SITE FOR RESIDUE SQD f 102 source : SC9 10) chain x residue 11 type sequence T description BINDING SITE FOR RESIDUE BCR h 101 source : TC1 11) chain x residue 16 type sequence L description BINDING SITE FOR RESIDUE BCR h 101 source : TC1

Display surface Download Links