eF-site ID 4ixr-i PDB Code 4ixr Chain i click to enlarge Title RT fs X-ray diffraction of Photosystem II, first illuminated state Classification PHOTOSYNTHESIS Compound Photosystem Q(B) protein 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence i:  METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK Description Functional site 1) chain i residue 1 type sequence M description BINDING SITE FOR RESIDUE LMT B 629 source : FC2 2) chain i residue 4 type sequence L description BINDING SITE FOR RESIDUE LMT B 629 source : FC2 3) chain i residue 9 type sequence Y description BINDING SITE FOR RESIDUE CLA a 409 source : LC4 4) chain i residue 12 type sequence V description BINDING SITE FOR RESIDUE CLA a 409 source : LC4 5) chain i residue 15 type sequence F description BINDING SITE FOR RESIDUE CLA a 409 source : LC4 6) chain i residue 5 type sequence K description BINDING SITE FOR RESIDUE DGD a 413 source : LC8 7) chain i residue 9 type sequence Y description BINDING SITE FOR RESIDUE DGD a 413 source : LC8 8) chain i residue 23 type sequence F description BINDING SITE FOR RESIDUE CLA c 505 source : PC9 9) chain i residue 20 type sequence V description BINDING SITE FOR RESIDUE BCR c 515 source : RC1 10) chain i residue 1 type sequence M description BINDING SITE FOR RESIDUE LMG i 101 source : TC2 11) chain i residue 3 type sequence T description BINDING SITE FOR RESIDUE LMG i 101 source : TC2 12) chain i residue 4 type sequence L description BINDING SITE FOR RESIDUE LMG i 101 source : TC2 13) chain i residue 3 type sequence T description BINDING SITE FOR RESIDUE LMT i 102 source : TC3 14) chain i residue 6 type sequence I description BINDING SITE FOR RESIDUE LMT i 102 source : TC3 15) chain i residue 10 type sequence I description BINDING SITE FOR RESIDUE LMT i 102 source : TC3 16) chain i residue 14 type sequence F description BINDING SITE FOR RESIDUE LMT i 102 source : TC3

Display surface Download Links