eF-site ID 4ixr-h PDB Code 4ixr Chain h click to enlarge Title RT fs X-ray diffraction of Photosystem II, first illuminated state Classification PHOTOSYNTHESIS Compound Photosystem Q(B) protein 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence h:  ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVF LLIILEIYNSTLILDGVNVSWKALG Description Functional site 1) chain h residue 41 type sequence F description BINDING SITE FOR RESIDUE CLA b 605 source : MC9 2) chain h residue 44 type sequence I description BINDING SITE FOR RESIDUE CLA b 605 source : MC9 3) chain h residue 38 type sequence F description BINDING SITE FOR RESIDUE CLA b 606 source : NC1 4) chain h residue 41 type sequence F description BINDING SITE FOR RESIDUE CLA b 606 source : NC1 5) chain h residue 45 type sequence I description BINDING SITE FOR RESIDUE CLA b 606 source : NC1 6) chain h residue 49 type sequence Y description BINDING SITE FOR RESIDUE CLA b 606 source : NC1 7) chain h residue 38 type sequence F description BINDING SITE FOR RESIDUE CLA b 607 source : NC2 8) chain h residue 42 type sequence L description BINDING SITE FOR RESIDUE CLA b 607 source : NC2 9) chain h residue 27 type sequence T description BINDING SITE FOR RESIDUE CLA b 613 source : NC8 10) chain h residue 28 type sequence T description BINDING SITE FOR RESIDUE CLA b 613 source : NC8 11) chain h residue 31 type sequence M description BINDING SITE FOR RESIDUE CLA b 613 source : NC8 12) chain h residue 34 type sequence F description BINDING SITE FOR RESIDUE CLA b 613 source : NC8 13) chain h residue 35 type sequence M description BINDING SITE FOR RESIDUE CLA b 613 source : NC8 14) chain h residue 14 type sequence L description BINDING SITE FOR RESIDUE CLA b 619 source : OC5 15) chain h residue 5 type sequence T description BINDING SITE FOR RESIDUE CLA b 620 source : OC6 16) chain h residue 49 type sequence Y description BINDING SITE FOR RESIDUE DGD b 623 source : OC9 17) chain h residue 50 type sequence N description BINDING SITE FOR RESIDUE DGD b 623 source : OC9 18) chain h residue 60 type sequence V description BINDING SITE FOR RESIDUE DGD b 623 source : OC9 19) chain h residue 61 type sequence S description BINDING SITE FOR RESIDUE DGD b 623 source : OC9 20) chain h residue 62 type sequence W description BINDING SITE FOR RESIDUE DGD b 623 source : OC9 21) chain h residue 32 type sequence A description BINDING SITE FOR RESIDUE LMT b 627 source : PC4 22) chain h residue 35 type sequence M description BINDING SITE FOR RESIDUE BCR h 101 source : TC1 23) chain h residue 37 type sequence L description BINDING SITE FOR RESIDUE BCR h 101 source : TC1 24) chain h residue 38 type sequence F description BINDING SITE FOR RESIDUE BCR h 101 source : TC1 25) chain h residue 41 type sequence F description BINDING SITE FOR RESIDUE BCR h 101 source : TC1

Display surface Download Links