eF-site ID 4iur-ABC PDB Code 4iur Chain A, B, C click to enlarge Title crystal structure of SHH1 SAWADEE domain in complex with H3K9me3 peptide Classification GENE REGULATION Compound SHH1 SAWADEE Source Arabidopsis thaliana (Mouse-ear cress) (H32_ARATH) Sequence A:  ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSG FDNRHDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQ EREDQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTE ESLGLERICRRPE B:  SADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFS GFDNRHDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCF QEREDQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNT EESLGLERICRRP C:  TKQTARXS Description Functional site 1) chain B residue 191 type sequence C description BINDING SITE FOR RESIDUE ZN B 301 source : AC1 2) chain B residue 225 type sequence H description BINDING SITE FOR RESIDUE ZN B 301 source : AC1 3) chain B residue 230 type sequence C description BINDING SITE FOR RESIDUE ZN B 301 source : AC1 4) chain B residue 232 type sequence C description BINDING SITE FOR RESIDUE ZN B 301 source : AC1 5) chain B residue 129 type sequence F description BINDING SITE FOR RESIDUE CVM B 302 source : AC2 6) chain B residue 145 type sequence F description BINDING SITE FOR RESIDUE CVM B 302 source : AC2 7) chain B residue 175 type sequence V description BINDING SITE FOR RESIDUE CVM B 302 source : AC2 8) chain B residue 176 type sequence K description BINDING SITE FOR RESIDUE CVM B 302 source : AC2 9) chain B residue 179 type sequence V description BINDING SITE FOR RESIDUE CVM B 302 source : AC2 10) chain A residue 191 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC3 11) chain A residue 225 type sequence H description BINDING SITE FOR RESIDUE ZN A 301 source : AC3 12) chain A residue 230 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC3 13) chain A residue 232 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC3 14) chain A residue 145 type sequence F description BINDING SITE FOR RESIDUE CVM A 302 source : AC4 15) chain A residue 176 type sequence K description BINDING SITE FOR RESIDUE CVM A 302 source : AC4 16) chain A residue 179 type sequence V description BINDING SITE FOR RESIDUE CVM A 302 source : AC4 17) chain B residue 225 type SITE sequence H description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 18) chain B residue 230 type SITE sequence C description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 19) chain B residue 232 type SITE sequence C description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 191 type SITE sequence C description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 225 type SITE sequence H description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 230 type SITE sequence C description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 232 type SITE sequence C description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 24) chain C residue 4 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:12581305, ECO:0000269|PubMed:14712277, ECO:0000269|PubMed:15598823, ECO:0000269|PubMed:16258034 source Swiss-Prot : SWS_FT_FI2 25) chain C residue 9 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:12456661, ECO:0000269|PubMed:12581305, ECO:0000269|PubMed:14712277, ECO:0000269|PubMed:15014946, ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI3 26) chain C residue 10 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:14610360, ECO:0000269|PubMed:15753571 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links