eF-site ID 4iur-A PDB Code 4iur Chain A click to enlarge Title crystal structure of SHH1 SAWADEE domain in complex with H3K9me3 peptide Classification GENE REGULATION Compound SHH1 SAWADEE Source Arabidopsis thaliana (Mouse-ear cress) (H32_ARATH) Sequence A:  ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSG FDNRHDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQ EREDQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTE ESLGLERICRRPE Description Functional site 1) chain A residue 191 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC3 2) chain A residue 225 type sequence H description BINDING SITE FOR RESIDUE ZN A 301 source : AC3 3) chain A residue 230 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC3 4) chain A residue 232 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC3 5) chain A residue 145 type sequence F description BINDING SITE FOR RESIDUE CVM A 302 source : AC4 6) chain A residue 176 type sequence K description BINDING SITE FOR RESIDUE CVM A 302 source : AC4 7) chain A residue 179 type sequence V description BINDING SITE FOR RESIDUE CVM A 302 source : AC4 8) chain A residue 191 type SITE sequence C description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 225 type SITE sequence H description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 230 type SITE sequence C description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 232 type SITE sequence C description Not N6-methylated => ECO:0000269|PubMed:15598823 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links