eF-site ID 4ium-A PDB Code 4ium Chain A click to enlarge Title Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin Classification HYDROLASE/PROTEIN BINDING Compound papain-like protease 2 Source Equine arteritis virus (strain Bucyrus) (EAV) (UBC_HUMAN) Sequence A:  GYNPPGDGACGYRCLAFMNGATVVSAGCSSDLWCDDELAY RVFQLSPTFTVTIPGGRVCPNAKYAMICDKQHWRVKRAKG VGLCLDESCFRGICNCQRMSGPPPAPVSAAVLDHILEAAT FGNVRVV Description (1)  papain-like protease 2 (E.C.3.4.22.-), Ubiquitin Functional site 1) chain A residue 319 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 2) chain A residue 349 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 3) chain A residue 354 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 4) chain A residue 356 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 5) chain A residue 278 type sequence M description BINDING SITE FOR RESIDUE GOL A 502 source : AC2 6) chain A residue 280 type sequence G description BINDING SITE FOR RESIDUE GOL A 502 source : AC2 7) chain A residue 323 type sequence K description BINDING SITE FOR RESIDUE GOL A 502 source : AC2 8) chain A residue 324 type sequence Y description BINDING SITE FOR RESIDUE GOL A 502 source : AC2 9) chain A residue 313 type sequence I description BINDING SITE FOR RESIDUE GOL B 101 source : AC3 10) chain A residue 349 type SITE sequence C description Essential for function source Swiss-Prot : SWS_FT_FI2 11) chain A residue 354 type SITE sequence C description Essential for function source Swiss-Prot : SWS_FT_FI2 12) chain A residue 356 type SITE sequence C description Essential for function source Swiss-Prot : SWS_FT_FI2

Display surface Download Links