eF-site ID 4ipx-A PDB Code 4ipx Chain A click to enlarge Title Analyzing the visible conformational substates of the FK506 binding protein FKBP12 Classification ISOMERASE Compound Peptidyl-prolyl cis-trans isomerase FKBP1A Source Homo sapiens (Human) (FKB1A_HUMAN) Sequence A:  GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSR DRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDY AYGATGVPGIIPPHATLVFDVELLKLE Description Functional site 1) chain A residue 52 type sequence K description BINDING SITE FOR RESIDUE MPD A 201 source : AC1 2) chain A residue 53 type sequence Q description BINDING SITE FOR RESIDUE MPD A 201 source : AC1 3) chain A residue 54 type sequence E description BINDING SITE FOR RESIDUE MPD A 201 source : AC1 4) chain A residue 88 type sequence P description BINDING SITE FOR RESIDUE MPD A 201 source : AC1 5) chain A residue 89 type sequence G description BINDING SITE FOR RESIDUE MPD A 201 source : AC1 6) chain A residue 92 type sequence P description BINDING SITE FOR RESIDUE MPD A 201 source : AC1 7) chain A residue 93 type sequence P description BINDING SITE FOR RESIDUE MPD A 202 source : AC2 8) chain A residue 52 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P26883 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 26 type catalytic sequence Y description 362 source MCSA : MCSA1 10) chain A residue 36 type catalytic sequence F description 362 source MCSA : MCSA1 11) chain A residue 37 type catalytic sequence D description 362 source MCSA : MCSA1 12) chain A residue 56 type catalytic sequence I description 362 source MCSA : MCSA1 13) chain A residue 82 type catalytic sequence Y description 362 source MCSA : MCSA1 14) chain A residue 99 type catalytic sequence F description 362 source MCSA : MCSA1

Display surface Download Links