eF-site ID 4ik0-A PDB Code 4ik0 Chain A click to enlarge Title Crystal structure of diaminopimelate epimerase Y268A mutant from Escherichia coli Classification ISOMERASE Compound Diaminopimelate epimerase Source Escherichia coli (strain K12) (DAPF_ECOLI) Sequence A:  MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGV GFDQLLVVEPPYDPELDFHYRIFNADGSEVAQCGNGARCF ARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE PNFEPSAVPFRANKAEKTYIMRAAEQTILCGVVSMGNPHC VIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKRE HIRLRVYERGAGETQACGSGACAAVAVGIQQGLLAEEVRV ELPGGRLDIAWKGPGHPLYMTGPAVHVADGFIHL Description Functional site 1) chain A residue 79 type sequence C description BINDING SITE FOR RESIDUE IOD A 301 source : AC1 2) chain A residue 78 type sequence R description BINDING SITE FOR RESIDUE IOD A 303 source : AC2 3) chain A residue 171 type sequence A description BINDING SITE FOR RESIDUE IOD A 304 source : AC3 4) chain A residue 175 type sequence L description BINDING SITE FOR RESIDUE IOD A 304 source : AC3 5) chain A residue 201 type sequence H description BINDING SITE FOR RESIDUE IOD A 305 source : AC4 6) chain A residue 73 type ACT_SITE sequence C description Proton donor => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 217 type ACT_SITE sequence C description Proton acceptor => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 64 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI3 9) chain A residue 74 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI3 10) chain A residue 157 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 190 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 208 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 218 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 11 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 44 type BINDING sequence Q description BINDING => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 159 type SITE sequence H description Could be important to modulate the pK values of the two catalytic cysteine residues => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI4 17) chain A residue 208 type SITE sequence E description Could be important to modulate the pK values of the two catalytic cysteine residues => ECO:0000255|HAMAP-Rule:MF_00197 source Swiss-Prot : SWS_FT_FI4 18) chain A residue 268 type SITE sequence A description Important for dimerization => ECO:0000269|PubMed:23426375 source Swiss-Prot : SWS_FT_FI5 19) chain A residue 64-78 type prosite sequence NADGSEVAQCGNGAR description DAP_EPIMERASE Diaminopimelate epimerase signature. NaDGSevaqCGNGaR source prosite : PS01326

Display surface Download Links