eF-site ID 4ibs-D PDB Code 4ibs Chain D click to enlarge Title Human p53 core domain with hot spot mutation R273H (form I) Classification DNA BINDING PROTEIN Compound Cellular tumor antigen p53 Source Homo sapiens (Human) (P53_HUMAN) Sequence D:  SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFC QLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRR CPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHS VVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII TLEDSSGNLLGRNSFEVHVCACPGRDRRTEEENL Description Functional site 1) chain D residue 176 type sequence C description BINDING SITE FOR RESIDUE ZN D 301 source : AC4 2) chain D residue 179 type sequence H description BINDING SITE FOR RESIDUE ZN D 301 source : AC4 3) chain D residue 238 type sequence C description BINDING SITE FOR RESIDUE ZN D 301 source : AC4 4) chain D residue 242 type sequence C description BINDING SITE FOR RESIDUE ZN D 301 source : AC4 5) chain D residue 102 type sequence T description BINDING SITE FOR RESIDUE EDO D 302 source : AC5 6) chain D residue 131 type sequence N description BINDING SITE FOR RESIDUE EDO D 302 source : AC5 7) chain D residue 268 type sequence N description BINDING SITE FOR RESIDUE EDO D 302 source : AC5 8) chain D residue 269 type sequence S description BINDING SITE FOR RESIDUE EDO D 302 source : AC5 9) chain D residue 120 type MOD_RES sequence K description N6-acetyllysine; by KAT6A => ECO:0000269|PubMed:23431171 source Swiss-Prot : SWS_FT_FI4 10) chain D residue 183 type MOD_RES sequence S description Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI5 11) chain D residue 269 type MOD_RES sequence S description Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI5 12) chain D residue 284 type MOD_RES sequence T description Phosphothreonine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI6 13) chain D residue 120 type SITE sequence K description Interaction with DNA => ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:18996393, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI3 14) chain D residue 176 type BINDING sequence C description BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI2 15) chain D residue 179 type BINDING sequence H description BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI2 16) chain D residue 238 type BINDING sequence C description BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI2 17) chain D residue 242 type BINDING sequence C description BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links