eF-site ID 4iar-A PDB Code 4iar Chain A click to enlarge Title Crystal structure of the chimeric protein of 5-HT1B-BRIL in complex with ergotamine (PSI Community Target) Classification SIGNALING PROTEIN, ELECTRON TRANSPORT Compound Chimera protein of human 5-hydroxytryptamine receptor 1B and E. Coli soluble cytochrome b562 Source Homo sapiens (Human) (5HT1B_HUMAN) Sequence A:  YIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRT RKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTL GQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITDAVEY SAKRTPKRAAVMIALVWVFSISISLPPFFWRQASECVVNT DHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIADLE DNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKAT PPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKV KEAQAAAEQLKTTRNAYIQKYLAARERKATKTLGIILGAF IVCWLPFFIISLVMPIWFHLAIFDFFTWLGYLNSLINPII YTMSNEDFKQAFHKLIRFK Description Functional site 1) chain A residue 129 type sequence D description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 2) chain A residue 130 type sequence I description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 3) chain A residue 133 type sequence C description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 4) chain A residue 134 type sequence T description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 5) chain A residue 199 type sequence C description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 6) chain A residue 200 type sequence V description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 7) chain A residue 201 type sequence V description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 8) chain A residue 216 type sequence A description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 9) chain A residue 327 type sequence W description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 10) chain A residue 330 type sequence F description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 11) chain A residue 334 type sequence S description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 12) chain A residue 348 type sequence L description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 13) chain A residue 351 type sequence F description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 14) chain A residue 352 type sequence D description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 15) chain A residue 355 type sequence T description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 16) chain A residue 359 type sequence Y description BINDING SITE FOR RESIDUE ERM A 2001 source : AC1 17) chain A residue 367 type sequence I description BINDING SITE FOR RESIDUE OLB A 2002 source : AC2 18) chain A residue 368 type sequence I description BINDING SITE FOR RESIDUE OLB A 2002 source : AC2 19) chain A residue 371 type sequence M description BINDING SITE FOR RESIDUE OLB A 2002 source : AC2 20) chain A residue 372 type sequence S description BINDING SITE FOR RESIDUE OLB A 2002 source : AC2 21) chain A residue 135-151 type prosite sequence ASIWHLCVIALDRYWAI description G_PROTEIN_RECEP_F1_1 G-protein coupled receptors family 1 signature. ASIwHLCVIALDRYWaI source prosite : PS00237 22) chain A residue 50-75 type TRANSMEM sequence VLLVMLLALITLATTLSNAFVIATVY description Helical; Name=1 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 129 type BINDING sequence D description BINDING => ECO:0000269|PubMed:23519210, ECO:0007744|PDB:4IAR source Swiss-Prot : SWS_FT_FI10 24) chain A residue 134 type BINDING sequence T description BINDING => ECO:0000269|PubMed:23519210, ECO:0007744|PDB:4IAR source Swiss-Prot : SWS_FT_FI10 25) chain A residue 201 type BINDING sequence V description BINDING => ECO:0000269|PubMed:23519210, ECO:0007744|PDB:4IAR source Swiss-Prot : SWS_FT_FI10 26) chain A residue 355 type SITE sequence T description Important for species-specific agonist sensitivity source Swiss-Prot : SWS_FT_FI11 27) chain A residue 1007 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI13 28) chain A residue 1102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI13 29) chain A residue 76-84 type TOPO_DOM sequence RTRKLHTPA description Cytoplasmic source Swiss-Prot : SWS_FT_FI2 30) chain A residue 146-165 type TOPO_DOM sequence DRYWAITDAVEYSAKRTPKR description Cytoplasmic source Swiss-Prot : SWS_FT_FI2 31) chain A residue 85-110 type TRANSMEM sequence NYLIASLAVTDLLVSILVMPISTMYT description Helical; Name=2 source Swiss-Prot : SWS_FT_FI3 32) chain A residue 111-123 type TOPO_DOM sequence VTGRWTLGQVVCD description Extracellular source Swiss-Prot : SWS_FT_FI4 33) chain A residue 188-205 type TOPO_DOM sequence RQASECVVNTDH description Extracellular source Swiss-Prot : SWS_FT_FI4 34) chain A residue 337-349 type TOPO_DOM sequence MPIWFHLA description Extracellular source Swiss-Prot : SWS_FT_FI4 35) chain A residue 124-145 type TRANSMEM sequence FWLSSDITCCTASIWHLCVIAL description Helical; Name=3 source Swiss-Prot : SWS_FT_FI5 36) chain A residue 166-187 type TRANSMEM sequence AAVMIALVWVFSISISLPPFFW description Helical; Name=4 source Swiss-Prot : SWS_FT_FI6 37) chain A residue 206-228 type TRANSMEM sequence ILYTVYSTVGAFYFPTLLLIALY description Helical; Name=5 source Swiss-Prot : SWS_FT_FI7 38) chain A residue 316-336 type TRANSMEM sequence LGIILGAFIVCWLPFFIISLV description Helical; Name=6 source Swiss-Prot : SWS_FT_FI8 39) chain A residue 350-371 type TRANSMEM sequence IFDFFTWLGYLNSLINPIIYTM description Helical; Name=7 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links