eF-site ID 4hw3-K PDB Code 4hw3 Chain K click to enlarge Title Discovery of potent Mcl-1 inhibitors using fragment-based methods and structure-based design Classification APOPTOSIS/INHIBITOR Compound Induced myeloid leukemia cell differentiation protein Mcl-1 Source Homo sapiens (Human) (MCL1_HUMAN) Sequence K:  GDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKAL ETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM IHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPL AESITDVLVRTKRDWLVKQRGWDGFVEFFHV Description Functional site 1) chain K residue 320 type sequence H description BINDING SITE FOR RESIDUE 19G I 400 source : AC9 2) chain K residue 228 type sequence F description BINDING SITE FOR RESIDUE 19G K 400 source : BC2 3) chain K residue 253 type sequence V description BINDING SITE FOR RESIDUE 19G K 400 source : BC2 4) chain K residue 254 type sequence F description BINDING SITE FOR RESIDUE 19G K 400 source : BC2 5) chain K residue 263 type sequence R description BINDING SITE FOR RESIDUE 19G K 400 source : BC2 6) chain K residue 267 type sequence L description BINDING SITE FOR RESIDUE 19G K 400 source : BC2 7) chain K residue 270 type sequence F description BINDING SITE FOR RESIDUE 19G K 400 source : BC2 8) chain K residue 294 type sequence I description BINDING SITE FOR RESIDUE 19G K 400 source : BC2 9) chain K residue 194 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) source Swiss-Prot : SWS_FT_FI1 10) chain K residue 197 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) source Swiss-Prot : SWS_FT_FI1

Display surface Download Links