eF-site ID 4hw3-H PDB Code 4hw3 Chain H click to enlarge Title Discovery of potent Mcl-1 inhibitors using fragment-based methods and structure-based design Classification APOPTOSIS/INHIBITOR Compound Induced myeloid leukemia cell differentiation protein Mcl-1 Source Homo sapiens (Human) (MCL1_HUMAN) Sequence H:  GDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKAL ETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM IHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPL AESITDVLVRTKRDWLVKQRGWDGFVEFFH Description Functional site 1) chain H residue 228 type sequence F description BINDING SITE FOR RESIDUE 19G H 400 source : AC8 2) chain H residue 250 type sequence M description BINDING SITE FOR RESIDUE 19G H 400 source : AC8 3) chain H residue 253 type sequence V description BINDING SITE FOR RESIDUE 19G H 400 source : AC8 4) chain H residue 263 type sequence R description BINDING SITE FOR RESIDUE 19G H 400 source : AC8 5) chain H residue 266 type sequence T description BINDING SITE FOR RESIDUE 19G H 400 source : AC8 6) chain H residue 267 type sequence L description BINDING SITE FOR RESIDUE 19G H 400 source : AC8 7) chain H residue 270 type sequence F description BINDING SITE FOR RESIDUE 19G H 400 source : AC8 8) chain H residue 271 type sequence G description BINDING SITE FOR RESIDUE 19G H 400 source : AC8 9) chain H residue 194 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) source Swiss-Prot : SWS_FT_FI1 10) chain H residue 197 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) source Swiss-Prot : SWS_FT_FI1

Display surface Download Links