eF-site ID 4hfl-A
PDB Code 4hfl
Chain A

click to enlarge
Title Crystal structure of the type VI effector Tae4 from Enterobacter cloacae
Classification HYDROLASE
Compound Putative cytoplasmic protein
Source (D5C6F6_ENTCC)
Sequence A:  MSHMRPAFGAAWNRFKEVNVNVEQVGKLLGGKVQHNIDAG
IFKNACPIRMSYVLNYCGIPVPSNSKYATVTGSDKKRYMF
RVKDMIAFLPTVLGKADISVSSPTPAQFAGKQGIIIFTGH
GWLDATGHVTLWNGNICSDDCHFLNGSFIPTNATFWSLK
Description (1)  Putative cytoplasmic protein

Display surface

Download
Links