eF-site ID 4hcc-A PDB Code 4hcc Chain A click to enlarge Title The zinc ion bound form of crystal structure of E.coli ExoI-ssDNA complex Classification HYDROLASE/DNA Compound Exodeoxyribonuclease I Source Escherichia coli (strain K12) (4HCC) Sequence A:  QQSTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEP EVFYCKPADDYLPQPGAVLITGITPQEARAKGENEAAFAA RIHSLFTVPKTCILGYNNVRFDDEVTRNIFYRNFYDPYAW SWQHDNSRWDLLDVMRACYALRPEGINWPENLPSFRLEHL TKANGIEHSNAHDAMADVYATIAMAKLVKTRQPRLFDYLF THRNKHKLMALIDVPQMKPLVHVSGMFGAWRGNTSWVAPL AWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKTD LGDNAAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQH CLDNLKILRENPQVREKVVAIFAEPFTPSDNVDAQLYNGF FSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYR ARNFPGTLDYAEQQRWLEHRRQVFTPEFLQGYADELQMLV QQYADDKEKVALLKALWQYADEIVH Description Functional site 1) chain A residue 414 type sequence N description BINDING SITE FOR RESIDUE SO4 A 501 source : AC1 2) chain A residue 415 type sequence F description BINDING SITE FOR RESIDUE SO4 A 501 source : AC1 3) chain A residue 416 type sequence P description BINDING SITE FOR RESIDUE SO4 A 501 source : AC1 4) chain A residue 417 type sequence G description BINDING SITE FOR RESIDUE SO4 A 501 source : AC1 5) chain A residue 106 type sequence R description BINDING SITE FOR RESIDUE SO4 A 502 source : AC2 6) chain A residue 235 type sequence M description BINDING SITE FOR RESIDUE SO4 A 502 source : AC2 7) chain A residue 299 type sequence K description BINDING SITE FOR RESIDUE SO4 A 502 source : AC2 8) chain A residue 419 type sequence L description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 9) chain A residue 420 type sequence D description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 10) chain A residue 421 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 11) chain A residue 15 type sequence D description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 12) chain A residue 17 type sequence E description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 13) chain A residue 186 type sequence D description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 14) chain A residue 17 type sequence E description BINDING SITE FOR RESIDUE IPA A 505 source : AC5 15) chain A residue 18 type sequence T description BINDING SITE FOR RESIDUE IPA A 505 source : AC5 16) chain A residue 214 type sequence K description BINDING SITE FOR RESIDUE SO4 B 501 source : AC6 17) chain A residue 215 type sequence H description BINDING SITE FOR RESIDUE SO4 B 501 source : AC6 18) chain A residue 256 type sequence R description BINDING SITE FOR RESIDUE SO4 B 501 source : AC6 19) chain A residue 430 type sequence H description BINDING SITE FOR RESIDUE SO4 B 502 source : AC7 20) chain A residue 433 type sequence Q description BINDING SITE FOR RESIDUE SO4 B 502 source : AC7 21) chain A residue 434 type sequence V description BINDING SITE FOR RESIDUE SO4 B 502 source : AC7 22) chain A residue 332 type sequence D description BINDING SITE FOR RESIDUE SO4 B 504 source : AC9 23) chain A residue 442 type sequence G description BINDING SITE FOR RESIDUE IPA B 506 source : BC2 24) chain A residue 443 type sequence Y description BINDING SITE FOR RESIDUE IPA B 506 source : BC2 25) chain A residue 446 type sequence E description BINDING SITE FOR RESIDUE IPA B 506 source : BC2 26) chain A residue 15 type sequence D description BINDING SITE FOR RESIDUE PO4 C 101 source : BC4 27) chain A residue 17 type sequence E description BINDING SITE FOR RESIDUE PO4 C 101 source : BC4 28) chain A residue 181 type sequence H description BINDING SITE FOR RESIDUE PO4 C 101 source : BC4 29) chain A residue 186 type sequence D description BINDING SITE FOR RESIDUE PO4 C 101 source : BC4 30) chain A residue 17 type BINDING sequence E description BINDING => ECO:0000269|PubMed:18219121 source Swiss-Prot : SWS_FT_FI2 31) chain A residue 165 type BINDING sequence R description BINDING => ECO:0000269|PubMed:18219121 source Swiss-Prot : SWS_FT_FI2 32) chain A residue 186 type BINDING sequence D description BINDING => ECO:0000269|PubMed:18219121 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 338 type SITE sequence R description Important for interaction with ssb => ECO:0000305|PubMed:20018747 source Swiss-Prot : SWS_FT_FI7 34) chain A residue 15 type BINDING sequence D description BINDING => ECO:0000269|PubMed:11101894, ECO:0000269|PubMed:18219121, ECO:0000269|PubMed:18591666, ECO:0000269|PubMed:20018747, ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 18 type SITE sequence T description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 36) chain A residue 371 type SITE sequence F description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 37) chain A residue 66 type SITE sequence I description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 38) chain A residue 113 type SITE sequence R description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 39) chain A residue 124 type SITE sequence Y description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 40) chain A residue 128 type SITE sequence W description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 41) chain A residue 142 type SITE sequence R description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 42) chain A residue 214 type SITE sequence K description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 43) chain A residue 284 type SITE sequence Y description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 44) chain A residue 368 type SITE sequence Y description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 45) chain A residue 148 type SITE sequence R description Important for interaction with ssb => ECO:0000269|PubMed:18591666 source Swiss-Prot : SWS_FT_FI4 46) chain A residue 207 type SITE sequence Y description Important for interaction with ssb => ECO:0000269|PubMed:18591666 source Swiss-Prot : SWS_FT_FI4 47) chain A residue 311 type SITE sequence Q description Important for interaction with ssb => ECO:0000269|PubMed:18591666 source Swiss-Prot : SWS_FT_FI4 48) chain A residue 164 type SITE sequence F description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540, ECO:0007744|PDB:4HCC source Swiss-Prot : SWS_FT_FI5 49) chain A residue 257 type SITE sequence N description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540, ECO:0007744|PDB:4HCC source Swiss-Prot : SWS_FT_FI5 50) chain A residue 304 type SITE sequence N description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540, ECO:0007744|PDB:4HCC source Swiss-Prot : SWS_FT_FI5 51) chain A residue 181 type SITE sequence H description Important for activity => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links