eF-site ID 4hcb-A PDB Code 4hcb Chain A click to enlarge Title The metal-free form of crystal structure of E.coli ExoI-ssDNA complex Classification HYDROLASE/DNA Compound Exodeoxyribonuclease I Source Escherichia coli (strain K12) (4HCB) Sequence A:  QQSTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEP EVFYCKPADDYLPQPGAVLITGITPQEARAKGENEAAFAA RIHSLFTVPKTCILGYNNVRFDDEVTRNIFYRNFYDPYAW SWQHDNSRWDLLDVMRACYALRPEGINWPENLPSFRLEHL TKANGIEDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNK HKLMALIDVPQMKPLVHVSGMFGAWRGNTSWVAPLAWHPE NRNAVIMVDLAGDISPLLELDSDTLRERLYTAKTDLGDNA AVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNL KILRENPQVREKVVAIFAEAEPFTPSDNVDAQLYNGFFSD ADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARN FPGTLDYAEQQRWLEHRRQVFTPEFLQGYADELQMLVQQY ADDKEKVALLKALWQYADEIVH Description Functional site 1) chain A residue 430 type sequence H description BINDING SITE FOR RESIDUE GOL A 501 source : AC1 2) chain A residue 433 type sequence Q description BINDING SITE FOR RESIDUE GOL A 501 source : AC1 3) chain A residue 214 type sequence K description BINDING SITE FOR RESIDUE SO4 A 502 source : AC2 4) chain A residue 215 type sequence H description BINDING SITE FOR RESIDUE SO4 A 502 source : AC2 5) chain A residue 256 type sequence R description BINDING SITE FOR RESIDUE SO4 A 502 source : AC2 6) chain A residue 148 type sequence R description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 7) chain A residue 203 type sequence R description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 8) chain A residue 106 type sequence R description BINDING SITE FOR RESIDUE SO4 A 504 source : AC4 9) chain A residue 233 type sequence S description BINDING SITE FOR RESIDUE SO4 A 504 source : AC4 10) chain A residue 235 type sequence M description BINDING SITE FOR RESIDUE SO4 A 504 source : AC4 11) chain A residue 299 type sequence K description BINDING SITE FOR RESIDUE SO4 A 504 source : AC4 12) chain A residue 415 type sequence F description BINDING SITE FOR RESIDUE SO4 A 505 source : AC5 13) chain A residue 416 type sequence P description BINDING SITE FOR RESIDUE SO4 A 505 source : AC5 14) chain A residue 417 type sequence G description BINDING SITE FOR RESIDUE SO4 A 505 source : AC5 15) chain A residue 438 type sequence E description BINDING SITE FOR RESIDUE GOL B 501 source : AC6 16) chain A residue 328 type sequence Q description BINDING SITE FOR RESIDUE GOL B 502 source : AC7 17) chain A residue 332 type sequence D description BINDING SITE FOR RESIDUE GOL B 502 source : AC7 18) chain A residue 373 type sequence S description BINDING SITE FOR RESIDUE SO4 B 506 source : BC2 19) chain A residue 374 type sequence D description BINDING SITE FOR RESIDUE SO4 B 506 source : BC2 20) chain A residue 15 type BINDING sequence D description BINDING => ECO:0000269|PubMed:11101894, ECO:0000269|PubMed:18219121, ECO:0000269|PubMed:18591666, ECO:0000269|PubMed:20018747, ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 17 type BINDING sequence E description BINDING => ECO:0000269|PubMed:18219121 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 165 type BINDING sequence R description BINDING => ECO:0000269|PubMed:18219121 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 186 type BINDING sequence D description BINDING => ECO:0000269|PubMed:18219121 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 18 type SITE sequence T description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 25) chain A residue 371 type SITE sequence F description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 26) chain A residue 66 type SITE sequence I description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 27) chain A residue 113 type SITE sequence R description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 28) chain A residue 124 type SITE sequence Y description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 29) chain A residue 128 type SITE sequence W description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 30) chain A residue 142 type SITE sequence R description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 31) chain A residue 214 type SITE sequence K description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 32) chain A residue 284 type SITE sequence Y description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 33) chain A residue 368 type SITE sequence Y description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540 source Swiss-Prot : SWS_FT_FI3 34) chain A residue 148 type SITE sequence R description Important for interaction with ssb => ECO:0000269|PubMed:18591666 source Swiss-Prot : SWS_FT_FI4 35) chain A residue 207 type SITE sequence Y description Important for interaction with ssb => ECO:0000269|PubMed:18591666 source Swiss-Prot : SWS_FT_FI4 36) chain A residue 311 type SITE sequence Q description Important for interaction with ssb => ECO:0000269|PubMed:18591666 source Swiss-Prot : SWS_FT_FI4 37) chain A residue 338 type SITE sequence R description Important for interaction with ssb => ECO:0000305|PubMed:20018747 source Swiss-Prot : SWS_FT_FI7 38) chain A residue 164 type SITE sequence F description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540, ECO:0007744|PDB:4HCC source Swiss-Prot : SWS_FT_FI5 39) chain A residue 257 type SITE sequence N description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540, ECO:0007744|PDB:4HCC source Swiss-Prot : SWS_FT_FI5 40) chain A residue 304 type SITE sequence N description Interaction with single-stranded DNA => ECO:0000269|PubMed:23609540, ECO:0007744|PDB:4HCC source Swiss-Prot : SWS_FT_FI5

Display surface Download Links