eF-site ID 4hbm-H PDB Code 4hbm Chain H click to enlarge Title Ordering of the N Terminus of Human MDM2 by Small Molecule Inhibitors Classification ligase/ligase inhibitor Compound E3 ubiquitin-protein ligase Mdm2 Source Homo sapiens (Human) (MDM2_HUMAN) Sequence H:  VPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDT YTMKEVLFYLGQYIMTKRLYHIVYCSNDLLGDLFGVPSFS VKEHRKIYTMIYRNLVVVN Description Functional site 1) chain H residue 14 type sequence V description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8 2) chain H residue 16 type sequence T description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8 3) chain H residue 54 type sequence L description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8 4) chain H residue 58 type sequence G description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8 5) chain H residue 61 type sequence I description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8 6) chain H residue 62 type sequence M description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8 7) chain H residue 93 type sequence V description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8 8) chain H residue 94 type sequence K description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8 9) chain H residue 96 type sequence H description BINDING SITE FOR RESIDUE 0Y7 H 201 source : AC8

Display surface Download Links