eF-site ID 4hbm-E PDB Code 4hbm Chain E click to enlarge Title Ordering of the N Terminus of Human MDM2 by Small Molecule Inhibitors Classification ligase/ligase inhibitor Compound E3 ubiquitin-protein ligase Mdm2 Source Homo sapiens (Human) (MDM2_HUMAN) Sequence E:  SVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKD TYTMKEVLFYLGQYIMTKRLYQHIVYCSNDLLGDLFGVPS FSVKEHRKIYTMIYRNLVVVN Description Functional site 1) chain E residue 59 type sequence Q description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 2) chain E residue 14 type sequence V description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5 3) chain E residue 16 type sequence T description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5 4) chain E residue 54 type sequence L description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5 5) chain E residue 58 type sequence G description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5 6) chain E residue 61 type sequence I description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5 7) chain E residue 93 type sequence V description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5 8) chain E residue 94 type sequence K description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5 9) chain E residue 96 type sequence H description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5 10) chain E residue 100 type sequence Y description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5

Display surface Download Links