eF-site ID 4hbm-D PDB Code 4hbm Chain D click to enlarge Title Ordering of the N Terminus of Human MDM2 by Small Molecule Inhibitors Classification ligase/ligase inhibitor Compound E3 ubiquitin-protein ligase Mdm2 Source Homo sapiens (Human) (MDM2_HUMAN) Sequence D:  SVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKD TYTMKEVLFYLGQYIMTKRLYHIVYCSNDLLGDLFGVPSF SVKEHRKIYTMIYRNLVVV Description Functional site 1) chain D residue 14 type sequence V description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 2) chain D residue 16 type sequence T description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 3) chain D residue 54 type sequence L description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 4) chain D residue 58 type sequence G description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 5) chain D residue 61 type sequence I description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 6) chain D residue 62 type sequence M description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 7) chain D residue 93 type sequence V description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 8) chain D residue 94 type sequence K description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 9) chain D residue 96 type sequence H description BINDING SITE FOR RESIDUE 0Y7 D 201 source : AC4 10) chain D residue 59 type sequence Q description BINDING SITE FOR RESIDUE 0Y7 F 201 source : AC6

Display surface Download Links