eF-site ID 4hbm-C PDB Code 4hbm Chain C click to enlarge Title Ordering of the N Terminus of Human MDM2 by Small Molecule Inhibitors Classification ligase/ligase inhibitor Compound E3 ubiquitin-protein ligase Mdm2 Source Homo sapiens (Human) (MDM2_HUMAN) Sequence C:  VPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDT YTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFG VPSFSVKEHRKIYTMIYRNLVVVN Description Functional site 1) chain C residue 14 type sequence V description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 2) chain C residue 16 type sequence T description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 3) chain C residue 54 type sequence L description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 4) chain C residue 58 type sequence G description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 5) chain C residue 61 type sequence I description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 6) chain C residue 93 type sequence V description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 7) chain C residue 94 type sequence K description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 8) chain C residue 96 type sequence H description BINDING SITE FOR RESIDUE 0Y7 C 201 source : AC3 9) chain C residue 59 type sequence Q description BINDING SITE FOR RESIDUE 0Y7 E 201 source : AC5

Display surface Download Links