eF-site ID 4hbm-A PDB Code 4hbm Chain A click to enlarge Title Ordering of the N Terminus of Human MDM2 by Small Molecule Inhibitors Classification ligase/ligase inhibitor Compound E3 ubiquitin-protein ligase Mdm2 Source Homo sapiens (Human) (MDM2_HUMAN) Sequence A:  MSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQK DTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDL FGVPSFSVKEHRKIYTMIYRNLVVVN Description Functional site 1) chain A residue 16 type sequence T description BINDING SITE FOR RESIDUE 0Y7 A 201 source : AC1 2) chain A residue 54 type sequence L description BINDING SITE FOR RESIDUE 0Y7 A 201 source : AC1 3) chain A residue 58 type sequence G description BINDING SITE FOR RESIDUE 0Y7 A 201 source : AC1 4) chain A residue 61 type sequence I description BINDING SITE FOR RESIDUE 0Y7 A 201 source : AC1 5) chain A residue 93 type sequence V description BINDING SITE FOR RESIDUE 0Y7 A 201 source : AC1 6) chain A residue 94 type sequence K description BINDING SITE FOR RESIDUE 0Y7 A 201 source : AC1 7) chain A residue 96 type sequence H description BINDING SITE FOR RESIDUE 0Y7 A 201 source : AC1 8) chain A residue 100 type sequence Y description BINDING SITE FOR RESIDUE 0Y7 A 201 source : AC1

Display surface Download Links