eF-site ID 4h86-A PDB Code 4h86 Chain A click to enlarge Title Crystal structure of Ahp1 from Saccharomyces cerevisiae in reduced form Classification OXIDOREDUCTASE Compound Peroxiredoxin type-2 Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (AHP1_YEAST) Sequence A:  GLVPRGSHMASMSDLVNKKFPAGDYKFQYIAISQSDADSE SCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPG YINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDT THIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENG IVTYAAKETNPGTDVTVSSVESVLAHL Description Functional site 1) chain A residue 48 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI6 2) chain A residue 113 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI6 3) chain A residue 62 type ACT_SITE sequence C description Cysteine sulfenic acid (-SOH) intermediate => ECO:0000305|PubMed:22474296 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 2 type MOD_RES sequence S description N-acetylserine => ECO:0000269|Ref.4 source Swiss-Prot : SWS_FT_FI2 5) chain A residue 28 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI3 6) chain A residue 116 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 59 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI4 8) chain A residue 32 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in URM1) => ECO:0000305|PubMed:21209336 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links