eF-site ID 4h2y-A PDB Code 4h2y Chain A click to enlarge Title Crystal structure of engineered Bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from Agrobacterium tumefaciens and ATP Classification LIGASE Compound Amino acid--[acyl-carrier-protein] ligase 1 Source Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) (AACP_AGRT5) Sequence A:  DPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSH REAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHG TEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPI AASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREY VCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPF FGRAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYH REHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGT DLSAWPAKVRDILGL Description (1)  Amino acid--[acyl-carrier-protein] ligase 1 (E.C.6.2.1.-), Aminoacyl carrier protein Functional site 1) chain A residue 131 type sequence C description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 2) chain A residue 176 type sequence E description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 3) chain A residue 279 type sequence C description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 4) chain A residue 159 type sequence R description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 5) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 6) chain A residue 169 type sequence L description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 7) chain A residue 172 type sequence F description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 8) chain A residue 174 type sequence M description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 9) chain A residue 215 type sequence D description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 10) chain A residue 216 type sequence P description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 11) chain A residue 235 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 12) chain A residue 250 type sequence A description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 13) chain A residue 251 type sequence C description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 14) chain A residue 253 type sequence S description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 15) chain A residue 283 type sequence G description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 16) chain A residue 286 type sequence R description BINDING SITE FOR RESIDUE ATP A 402 source : AC2 17) chain A residue 237 type sequence E description BINDING SITE FOR RESIDUE MG A 403 source : AC3 18) chain A residue 250 type sequence A description BINDING SITE FOR RESIDUE MG A 403 source : AC3 19) chain A residue 132 type sequence Y description BINDING SITE FOR RESIDUE PNS D 101 source : AC7 20) chain A residue 215 type sequence D description BINDING SITE FOR RESIDUE PNS D 101 source : AC7 21) chain A residue 228 type sequence N description BINDING SITE FOR RESIDUE PNS D 101 source : AC7 22) chain A residue 232 type sequence Q description BINDING SITE FOR RESIDUE PNS D 101 source : AC7 23) chain A residue 255 type sequence N description BINDING SITE FOR RESIDUE PNS D 101 source : AC7 24) chain A residue 257 type sequence H description BINDING SITE FOR RESIDUE PNS D 101 source : AC7 25) chain A residue 161 type MOD_RES sequence E description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 168 type MOD_RES sequence R description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 176 type MOD_RES sequence E description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 235 type MOD_RES sequence K description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 250 type MOD_RES sequence A description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 279 type MOD_RES sequence C description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 286 type MOD_RES sequence R description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links