eF-site ID 4h2s-A PDB Code 4h2s Chain A click to enlarge Title Crystal structure of Bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with cognate carrier protein and AMP Classification LIGASE Compound Amino acid--[acyl-carrier-protein] ligase 1 Source Bradyrhizobium japonicum (strain USDA 110) (AACP1_BRAJA) Sequence A:  DPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSH REAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHG TEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPI AASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREY VCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPF FGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYH REHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGT DLSAWPAKVRDILGL Description Functional site 1) chain A residue 131 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 2) chain A residue 176 type sequence E description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 3) chain A residue 279 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 4) chain A residue 159 type sequence R description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 5) chain A residue 161 type sequence E description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 6) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 7) chain A residue 169 type sequence L description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 8) chain A residue 172 type sequence F description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 9) chain A residue 174 type sequence M description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 10) chain A residue 235 type sequence K description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 11) chain A residue 250 type sequence A description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 12) chain A residue 251 type sequence C description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 13) chain A residue 252 type sequence M description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 14) chain A residue 253 type sequence S description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 15) chain A residue 283 type sequence G description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 16) chain A residue 286 type sequence R description BINDING SITE FOR RESIDUE AMP A 1001 source : AC2 17) chain A residue 132 type sequence Y description BINDING SITE FOR RESIDUE PNS C 1000 source : AC6 18) chain A residue 215 type sequence D description BINDING SITE FOR RESIDUE PNS C 1000 source : AC6 19) chain A residue 229 type sequence Q description BINDING SITE FOR RESIDUE PNS C 1000 source : AC6 20) chain A residue 232 type sequence Q description BINDING SITE FOR RESIDUE PNS C 1000 source : AC6 21) chain A residue 255 type sequence N description BINDING SITE FOR RESIDUE PNS C 1000 source : AC6 22) chain A residue 257 type sequence H description BINDING SITE FOR RESIDUE PNS C 1000 source : AC6 23) chain A residue 279 type sequence C description BINDING SITE FOR RESIDUE PNS C 1000 source : AC6 24) chain A residue 161 type MOD_RES sequence E description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 168 type MOD_RES sequence R description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 176 type MOD_RES sequence E description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 235 type MOD_RES sequence K description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 250 type MOD_RES sequence A description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 279 type MOD_RES sequence C description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 286 type MOD_RES sequence R description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links