eF-site ID 4h10-ABCD
PDB Code 4h10
Chain A, B, C, D

click to enlarge
Title Intermolecular recognition revealed by the complex structure of human CLOCK-BMAL1 basic Helix-Loop-Helix domains with E-box DNA
Classification TRANSCRIPTION/DNA
Compound Aryl hydrocarbon receptor nuclear translocator-like protein 1
Source Homo sapiens (Human) (4H10)
Sequence A:  RIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRK
LDKLTVLRMAVQHMKTLRGA
B:  KDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDK
STVLQKSIDFLRKHKEITAWLEH
C:  AGGAACACGTGACCC
D:  TGGGTCACGTGTTCC
Description (1)  Aryl hydrocarbon receptor nuclear translocator-like protein 1, Circadian locomoter output cycles protein kaput (E.C.2.3.1.48)/DNA complex

Display surface

Download
Links