eF-site ID 4gv3-A PDB Code 4gv3 Chain A click to enlarge Title Structures of Lassa and Tacaribe viral nucleoproteins with or without 5 triphosphate dsRNA substrate reveal a unique 3 -5 exoribonuclease mechanism to suppress type I interferon production Classification RNA BINDING PROTEIN/RNA Compound RNA (5'-R(*(GTP)P*GP*GP*C)-3') Source Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV) (4GV3) Sequence A:  GAMDHVEFGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPE DPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDV TDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQG RKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVE KEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFR TSPRVVL Description Functional site 1) chain A residue 389 type sequence D description BINDING SITE FOR RESIDUE MN B 101 source : AC1 2) chain A residue 399 type sequence E description BINDING SITE FOR RESIDUE ZN A 601 source : AC2 3) chain A residue 506 type sequence C description BINDING SITE FOR RESIDUE ZN A 601 source : AC2 4) chain A residue 509 type sequence H description BINDING SITE FOR RESIDUE ZN A 601 source : AC2 5) chain A residue 529 type sequence C description BINDING SITE FOR RESIDUE ZN A 601 source : AC2 6) chain A residue 389 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_04085, ECO:0000269|PubMed:21085117, ECO:0000269|PubMed:21262835 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 391 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_04085, ECO:0000269|PubMed:21085117, ECO:0000269|PubMed:21262835 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 533 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_04085, ECO:0000269|PubMed:21085117, ECO:0000269|PubMed:21262835 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 529 type BINDING sequence C description BINDING => ECO:0000255|HAMAP-Rule:MF_04085, ECO:0000269|PubMed:21085117, ECO:0000269|PubMed:21262835, ECO:0000269|PubMed:22937163, ECO:0000269|PubMed:23615902 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 399 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_04085, ECO:0000269|PubMed:21085117, ECO:0000269|PubMed:21262835, ECO:0000269|PubMed:22937163, ECO:0000269|PubMed:23615902 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 506 type BINDING sequence C description BINDING => ECO:0000255|HAMAP-Rule:MF_04085, ECO:0000269|PubMed:21085117, ECO:0000269|PubMed:21262835, ECO:0000269|PubMed:22937163, ECO:0000269|PubMed:23615902 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 509 type BINDING sequence H description BINDING => ECO:0000255|HAMAP-Rule:MF_04085, ECO:0000269|PubMed:21085117, ECO:0000269|PubMed:21262835, ECO:0000269|PubMed:22937163, ECO:0000269|PubMed:23615902 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 466 type SITE sequence D description Important for exonuclease activity => ECO:0000255|HAMAP-Rule:MF_04085, ECO:0000269|PubMed:21085117 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links